PDB entry 1h42

View 1h42 on RCSB PDB site
Description: ferredoxin:nadp+ reductase mutant with thr 155 replaced by gly, ala 160 replaced by thr and leu 263 replaced by pro (t155g-a160t-l263p)
Class: oxidoreductase
Keywords: oxidoreductase, flavoprotein, nadp, fad, fnr, nadp reductase
Deposited on 2002-09-26, released 2003-09-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin--nadp+ reductase
    Species: Anabaena sp. [TaxId:1168]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21890 (Start-303)
      • engineered mutation (155)
      • engineered mutation (160)
      • engineered mutation (263)
    Domains in SCOPe 2.07: d1h42a1, d1h42a2
  • Heterogens: FAD, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h42A (A:)
    mtqakakhadvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqs
    igiippgvdkngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcst
    ylthiepgsevkitgpvgkemllpddpeanvimlaggtgitpmrtylwrmfkdaeraanp
    eyqfkgfswlvfgvpttpnilykeeleeiqqkypdnfrltyaisreqknpqggrmyiqdr
    vaehadqlwqliknqkthtyicgprgmeegidaalsaaaakegvtwsdyqkdlkkagrwh
    vety
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h42A (A:)
    dvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsigiippgvd
    kngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcstylthiepgs
    evkitgpvgkemllpddpeanvimlaggtgitpmrtylwrmfkdaeraanpeyqfkgfsw
    lvfgvpttpnilykeeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadqlw
    qliknqkthtyicgprgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvety