PDB entry 1h40

View 1h40 on RCSB PDB site
Description: the structure of an ff domain from human hypa/fbp11
Deposited on 2002-09-23, released 2002-10-17
The last revision prior to the SCOP 1.65 freeze date was dated 2002-10-17, with a file datestamp of 2002-10-17.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1h40a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1h40A (A:)
gsqpakktytwntkeeakqafkellkekrvpsnasweqamkmiindprysalaklsekkq
afnaykvqtek

    Sequence, based on observed residues (ATOM records): (download) 
    >1h40A (A:)
qpakktytwntkeeakqafkellkekrvpsnasweqamkmiindprysalaklsekkqaf
naykvqtek