PDB entry 1h3y

View 1h3y on RCSB PDB site
Description: crystal structure of a human igg1 fc-fragment,high salt condition
Deposited on 2002-09-19, released 2003-01-23
The last revision prior to the SCOP 1.71 freeze date was dated 2003-01-23, with a file datestamp of 2003-01-23.
Experiment type: XRAY
Resolution: 4.1 Å
R-factor: 0.285
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h3yA (A:)
    tcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqv
    hnaktkpreqqynstyrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgqpr
    epqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsf
    flyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h3yA (A:)
    psvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreqqyn
    styrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgqprepqvytlppsree
    mtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrw
    qqgnvfscsvmhealhnhytqkslsls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h3yB (B:)
    tcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqv
    hnaktkpreqqynstyrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgqpr
    epqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsf
    flyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h3yB (B:)
    psvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreqqyn
    styrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgqprepqvytlppsree
    mtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrw
    qqgnvfscsvmhealhnhytqkslsls