PDB entry 1h3w

View 1h3w on RCSB PDB site
Description: Structural analysis of human IgG-Fc glycoforms reveals a correlation between glycosylation and structural integrity
Class: immune system
Keywords: immunoglobulin/fc-fragment, fc-fragment, glycosylation, fcgr, antibody, effector functions, immune system
Deposited on 2002-09-19, released 2003-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-29, with a file datestamp of 2017-03-24.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'M':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1H3W
    Domains in SCOPe 2.07: d1h3wm1, d1h3wm2
  • Heterogens: NAG, FUC, BMA, HOH

PDB Chain Sequences:

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1h3wM (M:)
    tcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqv
    hnaktkpreqqynstyrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgqpr
    epqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsf
    flyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h3wM (M:)
    psvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreqqyn
    styrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgqprepqvytlppsree
    mtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrw
    qqgnvfscsvmhealhnhytqkslsl