PDB entry 1h3v

View 1h3v on RCSB PDB site
Description: crystal structure of the human igg1 fc-fragment,glycoform (g2f)2,sg p212121
Class: immunoglobulin/fc-fragment
Keywords: fc-fragment, glycosylation, fcgr, antibody, effector functions
Deposited on 2002-09-19, released 2003-01-23
The last revision prior to the SCOP 1.73 freeze date was dated 2003-08-01, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.24
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ig gamma-1 chain C region
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1h3va1, d1h3va2
  • Chain 'B':
    Compound: Ig gamma-1 chain C region
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1h3vb1, d1h3vb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h3vA (A:)
    tcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqv
    hnaktkpreqqynstyrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgqpr
    epqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsf
    flyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h3vA (A:)
    psvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreqqyn
    styrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgqprepqvytlppsree
    mtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrw
    qqgnvfscsvmhealhnhytqkslslsp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h3vB (B:)
    tcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqv
    hnaktkpreqqynstyrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgqpr
    epqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsf
    flyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h3vB (B:)
    psvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreqqyn
    styrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgqprepqvytlppsree
    mtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrw
    qqgnvfscsvmhealhnhytqkslsls