PDB entry 1h3u

View 1h3u on RCSB PDB site
Description: crystal structure of the human igg1 fc-fragment,glycoform (m3n2f)2
Class: immunoglobulin/fc-fragment
Keywords: fc-fragment, glycosylation, fcgr, antibody, effector functions
Deposited on 2002-09-19, released 2003-01-23
The last revision prior to the SCOP 1.73 freeze date was dated 2003-01-23, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.253
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ig gamma-1 chain C region
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1H3U
    Domains in SCOP 1.73: d1h3ua1, d1h3ua2
  • Chain 'B':
    Compound: Ig gamma-1 chain C region
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1H3U
    Domains in SCOP 1.73: d1h3ub1, d1h3ub2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h3uA (A:)
    tcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqv
    hnaktkpreqqynstyrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgqpr
    epqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsf
    flyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h3uA (A:)
    psvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreqqyn
    styrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgqprepqvytlppsree
    mtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrw
    qqgnvfscsvmhealhnhytqkslslsp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h3uB (B:)
    tcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqv
    hnaktkpreqqynstyrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgqpr
    epqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsf
    flyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h3uB (B:)
    psvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreqqyn
    styrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgqprepqvytlppsree
    mtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrw
    qqgnvfscsvmhealhnhytqkslsls