PDB entry 1h3n

View 1h3n on RCSB PDB site
Description: leucyl-trna synthetase from thermus thermophilus complexed with a sulphamoyl analogue of leucyl-adenylate
Deposited on 2002-09-11, released 2002-09-27
The last revision prior to the SCOP 1.63 freeze date was dated 2002-11-19, with a file datestamp of 2002-11-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.205
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h3nA (A:)
    mekynphaieakwqrfweekgfmkakdlpggrgkqyvlvmfpypsgdlhmghlknytmgd
    vlarfrrmqgyevlhpmgwdafglpaenaalkfgvhpkdwtyanirqakeslrlmgilyd
    wdrevttcepeyyrwnqwiflkmwekglayrakglvnwcpkcqtvlaneqvvegrcwrhe
    dtpvekreleqwylritayaerllkdleglnwpekvkamqrawigrsegaeilfpvegke
    vripvfttrpdtlfgatflvlapehpltlelaapekreevlayveaakrkteierqaegr
    ektgvflgayalnpatgeripiwtadyvlfgygtgaimavpahdqrdyefarkfglpikk
    vierpgeplpeplerayeepgimvnsgpfdgteseegkrkviawleekglgkgrvtyrlr
    dwlisrqrywgtpipmvhceacgvvpvpeeelpvllpdlkdvedirpkgkspleahpefy
    ettcpkcggpakrdtdtmdtffdsswyylrytdphndrlpfdpekanawmpvdqyiggve
    havlhllysrfftkflhdlgmvkveepfqglftqgmvlawtdfgpvevegsvvrlpeptr
    irleipesalsledvrkmgaelrphedgtlhlwkpavmskskgngvmvgpfvkeqgadia
    ritilfaappenemvwteegvqgawrflnriyrrvaedrealletsgvfqaealegkdre
    lygklhetlkkvtedlealrfntaiaalmeflnalyeyrkdrpvtpvyrtairyylqmlf
    pfaphlaeelwhwfwpdslfeagwpeldekalek