PDB entry 1h3n

View 1h3n on RCSB PDB site
Description: leucyl-tRNA synthetase from thermus thermophilus complexed with a sulphamoyl analogue of leucyl-adenylate
Class: ligase
Keywords: aminoacyl-tRNA synthetase, class I aminoacyl-tRNA synthetase, ATP + l-leucine + tRNA (leu) -> amp + ppi + l-leucyl-tRNA(leu), ligase
Deposited on 2002-09-11, released 2002-09-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.205
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: leucyl-tRNA synthetase
    Species: THERMUS THERMOPHILUS [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • PDB 1H3N (0-End)
    Domains in SCOPe 2.07: d1h3na1, d1h3na2, d1h3na3
  • Heterogens: LEU, LMS, ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h3nA (A:)
    mekynphaieakwqrfweekgfmkakdlpggrgkqyvlvmfpypsgdlhmghlknytmgd
    vlarfrrmqgyevlhpmgwdafglpaenaalkfgvhpkdwtyanirqakeslrlmgilyd
    wdrevttcepeyyrwnqwiflkmwekglayrakglvnwcpkcqtvlaneqvvegrcwrhe
    dtpvekreleqwylritayaerllkdleglnwpekvkamqrawigrsegaeilfpvegke
    vripvfttrpdtlfgatflvlapehpltlelaapekreevlayveaakrkteierqaegr
    ektgvflgayalnpatgeripiwtadyvlfgygtgaimavpahdqrdyefarkfglpikk
    vierpgeplpeplerayeepgimvnsgpfdgteseegkrkviawleekglgkgrvtyrlr
    dwlisrqrywgtpipmvhceacgvvpvpeeelpvllpdlkdvedirpkgkspleahpefy
    ettcpkcggpakrdtdtmdtffdsswyylrytdphndrlpfdpekanawmpvdqyiggve
    havlhllysrfftkflhdlgmvkveepfqglftqgmvlawtdfgpvevegsvvrlpeptr
    irleipesalsledvrkmgaelrphedgtlhlwkpavmskskgngvmvgpfvkeqgadia
    ritilfaappenemvwteegvqgawrflnriyrrvaedrealletsgvfqaealegkdre
    lygklhetlkkvtedlealrfntaiaalmeflnalyeyrkdrpvtpvyrtairyylqmlf
    pfaphlaeelwhwfwpdslfeagwpeldekalekdvvevavqvngrvrgtihipkdaple
    varaealkvrnvrahlegkevvkeiyvpgkilnlvvrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h3nA (A:)
    mekynphaieakwqrfweekgfmkakdlpggrgkqyvlvmfpypsgdlhmghlknytmgd
    vlarfrrmqgyevlhpmgwdafglpaenaalkfgvhpkdwtyanirqakeslrlmgilyd
    wdrevttcepeyyrwnqwiflkmwekglayrakglvnwcpkcqtvlaneqvvegrcwrhe
    dtpvekreleqwylritayaerllkdleglnwpekvkamqrawigrsegaeilfpvegke
    vripvfttrpdtlfgatflvlapehpltlelaapekreevlayveaakrkteierqaegr
    ektgvflgayalnpatgeripiwtadyvlfgygtgaimavpahdqrdyefarkfglpikk
    vierpgeplpeplerayeepgimvnsgpfdgteseegkrkviawleekglgkgrvtyrlr
    dwlisrqrywgtpipmvhceacgvvpvpeeelpvllpdlkdvedirpkgkspleahpefy
    ettcpkcggpakrdtdtmdtffdsswyylrytdphndrlpfdpekanawmpvdqyiggve
    havlhllysrfftkflhdlgmvkveepfqglftqgmvlawtdfgpvevegsvvrlpeptr
    irleipesalsledvrkmgaelrphedgtlhlwkpavmskskgngvmvgpfvkeqgadia
    ritilfaappenemvwteegvqgawrflnriyrrvaedrealletsgvfqaealegkdre
    lygklhetlkkvtedlealrfntaiaalmeflnalyeyrkdrpvtpvyrtairyylqmlf
    pfaphlaeelwhwfwpdslfeagwpeldekalek