PDB entry 1h3f

View 1h3f on RCSB PDB site
Description: tyrosyl-trna synthetase from thermus thermophilus complexed with tyrosinol
Deposited on 2002-08-28, released 2002-09-12
The last revision prior to the SCOP 1.63 freeze date was dated 2002-12-05, with a file datestamp of 2002-12-05.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.234
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h3fA (A:)
    ghtpeealallkrgaeeivpeeellaklkegrpltvklgadptrpdlhlghavvlrkmrq
    fqelghkvvliigdftgmigdpsgrsktrppltleetrenaktyvaqagkilrqephlfe
    lrynsewlegltfkevvrltslmtvaqmleredfkkryeagipislhellypfaqaydsv
    airadvemggtdqrfnllvgrevqraygqspqvcflmpllvgldgrekmsksldnyiglt
    eppeamfkklmrvpdpllpsyfrlltdleeeeieallkagpvpahrvlarlltaayalpq
    ippridrafyeslgyaweafgrdkeagpeevrraearydevakggipeeipevtipasel
    kegriwvarlftlagltpsnaearrliqnrglrldgevltdpmlqvdlsrprilqrgkdr
    fvrvrlsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h3fA (A:)
    ghtpeealallkrgaeeivpeeellaklkegrpltvklgadptrpdlhlghavvlrkmrq
    fqelghkvvliigdftrenaktyvaqagkilrqephlfelrynsewlegltfkevvrlts
    lmtvaqmleredfkkryeagipislhellypfaqaydsvairadvemggtdqrfnllvgr
    evqraygqspqvcflmpllvgldgrekmsksldnyiglteppeamfkklmrvpdpllpsy
    frlltdleeeeieallkagpvpahrvlarlltaayalpqippridrafyeslgyaweafg
    rdkeagpeevrraearydevakeeipevtipaselkegriwvarlftlagltpsnaearr
    liqnrglrldgevltdpmlqvdlsrprilqrgkdrfvrvrlsd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h3fB (B:)
    ghtpeealallkrgaeeivpeeellaklkegrpltvklgadptrpdlhlghavvlrkmrq
    fqelghkvvliigdftgmigdpsgrsktrppltleetrenaktyvaqagkilrqephlfe
    lrynsewlegltfkevvrltslmtvaqmleredfkkryeagipislhellypfaqaydsv
    airadvemggtdqrfnllvgrevqraygqspqvcflmpllvgldgrekmsksldnyiglt
    eppeamfkklmrvpdpllpsyfrlltdleeeeieallkagpvpahrvlarlltaayalpq
    ippridrafyeslgyaweafgrdkeagpeevrraearydevakggipeeipevtipasel
    kegriwvarlftlagltpsnaearrliqnrglrldgevltdpmlqvdlsrprilqrgkdr
    fvrvrlsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h3fB (B:)
    ghtpeealallkrgaeeivpeeellaklkegrpltvklgadptrpdlhlghavvlrkmrq
    fqelghkvvliigdftgmitleetrenaktyvaqagkilrqephlfelrynsewlegltf
    kevvrltslmtvaqmleredfkkryeagipislhellypfaqaydsvairadvemggtdq
    rfnllvgrevqraygqspqvcflmpllvgldgrekmsksldnyiglteppeamfkklmrv
    pdpllpsyfrlltdleeeeieallkagpvpahrvlarlltaayalpqippridrafyesl
    gyaweafgrdkeagpeevrraearydeipevtipaselkegriwvarlftlagltpsnae
    arrliqnrglrldgevltdpmlqvdlsrprilqrgkdrfvrvrlsd