PDB entry 1h3e

View 1h3e on RCSB PDB site
Description: tyrosyl-trna synthetase from thermus thermophilus complexed with wild- type trnatyr(gua) and with atp and tyrosinol
Deposited on 2002-08-28, released 2002-10-27
The last revision prior to the SCOP 1.63 freeze date was dated 2002-12-05, with a file datestamp of 2002-12-05.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.219
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h3eA (A:)
    htpeealallkrgaeeivpeeellaklkegrpltvklgadptrpdlhlghavvlrkmrqf
    qelghkvvliigdftgmigdpsgrsktrppltleetrenaktyvaqagkilrqephlfel
    rynsewlegltfkevvrltslmtvaqmleredfkkryeagipislhellypfaqaydsva
    iradvemggtdqrfnllvgrevqraygqspqvcflmpllvgldgrekmsksldnyiglte
    ppeamfkklmrvpdpllpsyfrlltdleeeeieallkagpvpahrvlarlltaayalpqi
    ppridrafyeslgyaweafgrdkeagpeevrraearydevakggipeeipevtipaselk
    egriwvarlftlagltpsnaearrliqnrglrldgevltdpmlqvdlsrprilqrgkdrf
    vrvrlsd