PDB entry 1h33

View 1h33 on RCSB PDB site
Description: oxidised soxax complex from rhodovulum sulfidophilum
Deposited on 2002-08-21, released 2002-11-07
The last revision prior to the SCOP 1.63 freeze date was dated 2002-11-07, with a file datestamp of 2002-11-07.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.179
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h33A (A:)
    gpddplvingeieivtraptpahladrfdeirsgwtfrtddtqalemddfensgmvfvee
    aravwdrpegtegkacadchgavddgmyglravypkyvesagkvrtveqminacrtsrmg
    apewdyigpdmtamvaliasvsrgmpvsvaidgpaqstwekgreiyytrygqldlscasc
    heqyfdhyiradhlsqgqingfpsyrlknarlnavhdrfrgcirdtrgvpfavgspefva
    lelyvasrgnglsvegpsvrn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h33B (B:)
    aevapgdvaidgqghvarpltdapgdpvegrrlmtdrsvgnciachevtemadaqfpgtv
    gpsldgvaarypeamirgilvnsknvfpetvmpayyrvegfnrpgiaftskpiegeirpl
    mtagqiedvvaylmtltq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h33B (B:)
    aevapgdvaidgqghvarpltdapgdpvegrrlmtdrsvgnciachevtemqfpgtvgps
    ldgvaarypeamirgilvnsknvfpetvmpayyrvegfnrpgiaftskpiegeirplmta
    gqiedvvaylmtltq