PDB entry 1h2p

View 1h2p on RCSB PDB site
Description: human cd55 domains 3 & 4
Deposited on 2002-08-13, released 2003-03-20
The last revision prior to the SCOP 1.67 freeze date was dated 2003-03-20, with a file datestamp of 2003-03-20.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.258
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1h2pP (P:)
kscpnpgqirngqidvpggilfgatisfscntgyklfgstssfclisgssvqwsdplpec
reiycpappqidngiiqgerdhygyrqsvtyacnkgftmigehsiyctvnndegewsgpp
pecrg