PDB entry 1h2o

View 1h2o on RCSB PDB site
Description: solution structure of the major cherry allergen pru av 1 mutant e45w
Class: allergen
Keywords: allergen, major cherry allergen, pathogenesis-related protein, heteronuclear nmr, structure, plant defense
Deposited on 2002-08-12, released 2003-08-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: major allergen pru av 1
  Species: Prunus avium [TaxId:42229]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O24248 (0-158)
    • engineered mutation (44)
  Domains in SCOPe 2.06: d1h2oa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1h2oA (A:)
  gvftyeseftseippprlfkafvldadnlvpkiapqaikhseilwgdggpgtikkitfge
  gsqygyvkhkidsidkenysysytliegdalgdtlekisyetklvaspsggsiikstshy
  htkgnveikeehvkagkekasnlfklietylkghpdayn