PDB entry 1h1x

View 1h1x on RCSB PDB site
Description: sperm whale myoglobin mutant t67r s92d
Class: oxygen transport
Keywords: oxygen transport, globin, peroxidase, oxygen storage, heme, muscle
Deposited on 2002-07-25, released 2003-10-23
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.121
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Database cross-references and differences (RAF-indexed):
    • PDB 1H1X (0-0)
      • engineered mutation (67)
      • engineered mutation (92)
      • conflict (122)
    • Uniprot P02185 (1-153)
    Domains in SCOPe 2.01: d1h1xa_
  • Heterogens: HEM, CYN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h1xA (A:)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
    dlkkhgvrvltalgailkkkghheaelkplaqdhatkhkipikylefiseaiihvlhsrh
    pgnfgadaqgamnkalelfrkdiaakykelgyqg