PDB entry 1h1o

View 1h1o on RCSB PDB site
Description: acidithiobacillus ferrooxidans cytochrome c4 structure supports a complex-induced tuning of electron transfer
Class: electron transport
Keywords: electron transport, c4, cytochrome, electron transfer, heme
Deposited on 2002-07-19, released 2003-07-17
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-10-12, with a file datestamp of 2011-10-07.
Experiment type: XRAY
Resolution: 2.13 Å
R-factor: 0.239
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c-552
    Species: THIOBACILLUS FERROOXIDANS [TaxId:920]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1h1oa1, d1h1oa2
  • Chain 'B':
    Compound: Cytochrome c-552
    Species: THIOBACILLUS FERROOXIDANS [TaxId:920]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1h1ob1, d1h1ob2
  • Heterogens: HEM, SO4, ZN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h1oA (A:)
    vgsadapapyrvssdcmvchgmtgrdtlypivprlagqhksymeaqlkaykdhsradqng
    eiymwpvaqaldsakitaladyfnaqkppmqssgikhagakegkaifnqgvtneqipacm
    echgsdgqgagpfprlagqrygyiiqqltyfhngtrvntlmnqiaknitvaqmkdvaayl
    ssl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h1oA (A:)
    vssdcmvchgmtgrdtlypivprlagqhksymeaqlkaykdhsradqngeiymwpvaqal
    dsakitaladyfnaqkppmqssgikhagakegkaifnqgvtneqipacmechgsdgqgag
    pfprlagqrygyiiqqltyfhngtrvntlmnqiaknitvaqmkdvaaylssl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h1oB (B:)
    vgsadapapyrvssdcmvchgmtgrdtlypivprlagqhksymeaqlkaykdhsradqng
    eiymwpvaqaldsakitaladyfnaqkppmqssgikhagakegkaifnqgvtneqipacm
    echgsdgqgagpfprlagqrygyiiqqltyfhngtrvntlmnqiaknitvaqmkdvaayl
    ssl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h1oB (B:)
    ssdcmvchgmtgdtlypivprlagqhksymeaqlkaykdhsradqngeiymwpvaqalds
    akitaladyfnaqkppmqssgikhagakegkaifnqgvtneqipacmechgsdgqgagpf
    prlagqrygyiiqqltyfhngtrvntlmnqiaknitvaqmkdvaaylssl