PDB entry 1h0n

View 1h0n on RCSB PDB site
Description: cobalt substitution of mouse r2 ribonucleotide reductase to model the reactive diferrous state
Class: oxidoreductase
Keywords: oxidoreductase, ribonucleotide reductase, dinuclear metal-cluster
Deposited on 2002-06-26, released 2002-07-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.218
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonucleoside-diphosphate reductase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1h0na_
  • Heterogens: CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h0nA (A:)
    mlsvrtplatiadqqqlqlsplkrltladkentpptlsstrvlaskaarrifqdsaeles
    kaptnpsvedepllrenprrfvvfpieyhdiwqmykkaeasfwtaeevdlskdiqhweal
    kpderhfishvlaffaasdgivnenlverfsqevqvtearcfygfqiamenihsemysll
    idtyikdpkereylfnaietmpcvkkkadwalrwigdkeatygervvafaavegiffsgs
    fasifwlkkrglmpgltfsnelisrdeglhcdfaclmfkhlvhkpaeqrvreiitnavri
    eqefltealpvkligmnctlmkqyiefvadrlmlelgfnkifrvenpfdfmenislegkt
    nffekrvgeyqrmgvmsnstensftldadf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h0nA (A:)
    npsvedepllrenprrfvvfpieyhdiwqmykkaeasfwtaeevdlskdiqhwealkpde
    rhfishvlaffaasdgivnenlverfsqevqvtearcfygfqiamenihsemysllidty
    ikdpkereylfnaietmpcvkkkadwalrwigdkeatygervvafaavegiffsgsfasi
    fwlkkrglmpgltfsnelisrdeglhcdfaclmfkhlvhkpaeqrvreiitnavrieqef
    ltealpvkligmnctlmkqyiefvadrlmlelgfnkifrvenpfdfme