PDB entry 1h0d

View 1h0d on RCSB PDB site
Description: crystal structure of human angiogenin in complex with fab fragment of its monoclonal antibody mab 26-2f
Deposited on 2002-06-19, released 2003-06-19
The last revision prior to the SCOP 1.71 freeze date was dated 2003-07-10, with a file datestamp of 2003-07-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.232
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h0dA (A:)
    divltqspaslavslgqratiscrasesvdnygisfmswfqqkpgqppklliyaasnqgs
    gvparfsgsgsgtdfslnihpmeeddtamyfcqqskevpltfgagtklelkradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvrwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathaaspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h0dB (B:)
    evmlvesggglvkpggslklscaasgftfssytmswvrqtpekrlewvatissgggntyy
    pdsvkgrftisrdiakntlylqmsslrsedtalyyctrlgdygyaytmdywgqgtsvtvs
    sakttppsvyplapgggggggamvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
    dlytlsssvtvpsspwpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h0dC (C:)
    ednsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicenk
    ngnphrenlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpvhldqsif
    rrp