PDB entry 1gzk

View 1gzk on RCSB PDB site
Description: molecular mechanism for the regulation of protein kinase b/ akt by hydrophobic motif phosphorylation
Class: kinase
Keywords: transferase, serine/threonine-protein kinase, ATP-binding
Deposited on 2002-05-23, released 2003-05-22
The last revision prior to the SCOP 1.73 freeze date was dated 2003-05-22, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.248
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rac-beta serine/threonine protein kinase
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1gzka_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gzkA (A:)
    kvtmndfdylkllgkgtfgkvilvrekatgryyamkilrkeviiakdevahtvtesrvlq
    ntrhpfltalkyafqthdrlcfvmeyanggelffhlsrervfteerarfygaeivsaley
    lhsrdvvyrdiklenlmldkdghikitdfglckegisdgatmktfcgtpeylapevledn
    dygravdwwglgvvmyemmcgrlpfynqdherlfelilmeeirfprtlspeaksllagll
    kkdpkqrlgggpsdakevmehrfflsinwqdvvqkkllppfkpqvtsevdtryfddefta
    qsititppdrydslg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gzkA (A:)
    kvtmndfdylkllgkgtfgkvilvrekatgryyamkilrkevivtesrvlqntrhpflta
    lkyafqthdrlcfvmeyanggelffhlsrervfteerarfygaeivsaleylhsrdvvyr
    diklenlmldkdghikitdfgltpeylapevledndygravdwwglgvvmyemmcgrlpf
    ynqdherlfelilmeeirfprtlspeaksllagllkkdpkqrlgggpsdakevmehrffl
    sinwqdvvqkkllppfkpqvtsevdtryfdd