PDB entry 1gyz

View 1gyz on RCSB PDB site
Description: bacterial ribosomal protein l20 from aquifex aeolicus
Class: ribosomal protein
Keywords: ribosomal protein, ribosome, protein synthesis, translational control, rRNA-binding, complete proteome
Deposited on 2002-05-02, released 2002-05-10
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 50S ribosomal protein L20
    Species: Aquifex aeolicus [TaxId:224324]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1gyza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gyzA (A:)
    wiarinaavrayglnystfinglkkagieldrkiladmavrdpqafeqvvnkvkealqvq