PDB entry 1gyz

View 1gyz on RCSB PDB site
Description: bacterial ribosomal protein l20 from aquifex aeolicus
Class: ribosomal protein
Keywords: ribosome, protein synthesis, translational control, ribosomal protein, rRNA-binding, complete proteome
Deposited on 2002-05-02, released 2002-05-10
The last revision prior to the SCOP 1.75 freeze date was dated 2002-10-10, with a file datestamp of 2007-07-20.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 50S ribosomal protein L20
    Species: Aquifex aeolicus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1gyza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gyzA (A:)
    wiarinaavrayglnystfinglkkagieldrkiladmavrdpqafeqvvnkvkealqvq