PDB entry 1gya

View 1gya on RCSB PDB site
Description: n-glycan and polypeptide nmr solution structures of the adhesion domain of human cd2
Class: adhesion glycoprotein
Keywords: cell surface adhesion receptor, immunoglobulin superfamily v-set domain, t lymphocyte adhesion glycoprotein, adhesion glycoprotein
Deposited on 1995-05-26, released 1996-11-08
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human cd2
    Species: Homo sapiens [TaxId:9606]
    Gene: SCD2=182=
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1gyaa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gyaA (A:)
    keitnaletwgalgqdinldipsfqmsddiddikwektsdkkkiaqfrkeketfkekdty
    klfkngtlkikhlktddqdiykvsiydtkgknvlekifdlkiqer