PDB entry 1gxm

View 1gxm on RCSB PDB site
Description: family 10 polysaccharide lyase from cellvibrio cellulosa
Deposited on 2002-04-08, released 2002-10-04
The last revision prior to the SCOP 1.65 freeze date was dated 2002-10-04, with a file datestamp of 2002-10-04.
Experiment type: XRAY
Resolution: 1.32 Å
R-factor: 0.13205
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1gxma_
  • Chain 'B':
    Domains in SCOP 1.65: d1gxmb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gxmA (A:)
    glvprgshmtgrmltldgnpaanwlnnartkwsasradvvlsyqqnnggwpknldynsvg
    nggggnesgtidngatitemvflaevyksggntkyrdavrkaanflvnsqystgalpqfy
    plkggysdhatfndngmayaltvldfaankrapfdtdvfsdndrtrfktavtkgtdyilk
    aqwkqngvltvwcaqhgaldyqpkkarayeleslsgsesvgvlaflmtqpqtaeieqavr
    agvawfnsprtylegytydsslaatnpivpragskmwyrfydlntnrgffsdrdgskfyd
    itqmslerrtgyswggnygtsiinfaqkvgyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gxmA (A:)
    mtgrmltldgnpaanwlnnartkwsasradvvlsyqqnnggwpknldynsvgnggggnes
    gtidngatitemvflaevyksggntkyrdavrkaanflvnsqystgalpqfyplkggysd
    hatfndngmayaltvldfaankrapfdtdvfsdndrtrfktavtkgtdyilkaqwkqngv
    ltvwcaqhgaldyqpkkarayeleslsgsesvgvlaflmtqpqtaeieqavragvawfns
    prtylegytydsslaatnpivpragskmwyrfydlntnrgffsdrdgskfyditqmsler
    rtgyswggnygtsiinfaqkvgyl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gxmB (B:)
    glvprgshmtgrmltldgnpaanwlnnartkwsasradvvlsyqqnnggwpknldynsvg
    nggggnesgtidngatitemvflaevyksggntkyrdavrkaanflvnsqystgalpqfy
    plkggysdhatfndngmayaltvldfaankrapfdtdvfsdndrtrfktavtkgtdyilk
    aqwkqngvltvwcaqhgaldyqpkkarayeleslsgsesvgvlaflmtqpqtaeieqavr
    agvawfnsprtylegytydsslaatnpivpragskmwyrfydlntnrgffsdrdgskfyd
    itqmslerrtgyswggnygtsiinfaqkvgyl