PDB entry 1gwq

View 1gwq on RCSB PDB site
Description: human oestrogen receptor alpha ligand-binding domain in complex with raloxifene core and tif2 nrbox2 peptide
Class: nuclear receptor
Keywords: nuclear receptor, transcription factor, transactivation, agonist, af2 coactivator , receptor, activator, transcripti regulation, DNA-binding, nuclear protein, zinc finger, ster binding, phosphorylation, polymorphism, alternative splicin
Deposited on 2002-03-22, released 2002-08-29
The last revision prior to the SCOP 1.75 freeze date was dated 2002-08-29, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.206
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: oestrogen receptor
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1gwqa_
  • Chain 'B':
    Compound: oestrogen receptor
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1gwqb_
  • Chain 'C':
    Compound: nuclear receptor coactivator 2
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: nuclear receptor coactivator 2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZTW, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gwqA (A:)
    skknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminw
    akrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcveg
    mveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvld
    kitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydll
    lemldahr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gwqA (A:)
    skknslalsltadqmvsalldaeppilysepfseasmmglltnladrelvhminwakrvp
    gfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveif
    dmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdt
    lihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemld
    ahr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gwqB (B:)
    skknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminw
    akrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcveg
    mveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvld
    kitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydll
    lemldahr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gwqB (B:)
    skknslalsltadqmvsalldaeppilysefseasmmglltnladrelvhminwakrvpg
    fvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifd
    mllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtl
    ihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemlda
    hr
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.