PDB entry 1gwm

View 1gwm on RCSB PDB site
Description: carbohydrate binding module family29 complexed with glucohexaose
Deposited on 2002-03-19, released 2003-03-20
The last revision prior to the SCOP 1.71 freeze date was dated 2003-03-20, with a file datestamp of 2003-03-20.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.12942
AEROSPACI score: 0.87 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1gwma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1gwmA (A:)
mnvratytvifknasglpngydnwgwgctlsyyggamiinpqegkygavslkrnsgsfrg
gslrfdmknegkvkilvenseadekfevetispsdeyvtyildvdfdlpfdridfqdapg
ngdriwiknlvhstgsaddfvdpinlehhhhhh