PDB entry 1gw5

View 1gw5 on RCSB PDB site
Description: ap2 clathrin adaptor core
Deposited on 2002-03-06, released 2002-05-31
The last revision prior to the SCOP 1.65 freeze date was dated 2002-07-03, with a file datestamp of 2002-07-03.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: 0.26846
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gw5A (A:)
    mpavskgdgmrglavfisdirnckskeaeikrinkelanirskfkgdkaldgyskkkyvc
    kllfifllghdidfghmeavnllssnrytekqigylfisvlvnsnselirlinnaikndl
    asrnptfmglalhcianvgsremaeafageipkilvagdtmdsvkqsaalcllrlyrtsp
    dlvpmgdwtsrvvhllndqhlgvvtaatslittlaqknpeefktsvslavsrlsrivtsa
    stdlqdytyyfvpapwlsvkllrllqcypppedpavrgrltecletilnkaqeppkskkv
    qhsnaknavlfeaisliihhdsepnllvracnqlgqflqhretnlrylalesmctlasse
    fsheavkthietvinalkterdvsvrqravdllyamcdrsnaqqivaemlsyletadysi
    reeivlkvailaekyavdytwyvdtilnliriagdyvseevwyrviqivinrddvqgyaa
    ktvfealqapachenlvkvggyilgefgxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxdilatvle
    emppfperessilaklkkkkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gw5A (A:)
    gmrglavfisdirnckskeaeikrinkelanirskfkgdkaldgyskkkyvckllfifll
    ghdidfghmeavnllssnrytekqigylfisvlvnsnselirlinnaikndlasrnptfm
    glalhcianvgsremaeafageipkilvagdtmdsvkqsaalcllrlyrtspdlvpmgdw
    tsrvvhllndqhlgvvtaatslittlaqknpeefktsvslavsrlsrivtsastdlqdyt
    yyfvpapwlsvkllrllqcypppedpavrgrltecletilnkaqeppkskkvqhsnakna
    vlfeaisliihhdsepnllvracnqlgqflqhretnlrylalesmctlassefsheavkt
    hietvinalkterdvsvrqravdllyamcdrsnaqqivaemlsyletadysireeivlkv
    ailaekyavdytwyvdtilnliriagdyvseevwyrviqivinrddvqgyaaktvfealq
    apachenlvkvggyilgefgxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gw5B (B:)
    mtdskyfttnkkgeifelkaelnnekkekrkeavkkviaamtvgkdvsslfpdvvncmqt
    dnlelkklvylylmnyaksqpdmaimavnsfvkdcedpnpliralavrtmgcirvdkite
    ylceplrkclkdedpyvrktaavcvaklhdinaqmvedqgfldslrdliadsnpmvvana
    vaalseiseshpnsnlldlnpqninklltalnectewgqifildclsnynpkddreaqsi
    cervtprlshansavvlsavkvlmkflellpkdsdyynmllkklapplvtllsgepevqy
    valrninlivqkrpeilkqeikvffvkyndpiyvklekldimirlasqaniaqvlaelke
    yatevdvdfvrkavraigrcaikveqsaercvstlldliqtkvnyvvqeaivvirdifrk
    ypnkyesiiatlcenldsldepdaraamiwivgeyaeridnadellesflegfhdestqv
    qltlltaivklflkkpsetqelvqqvlsxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxieptlldelichigslasvyhkppnafvegshgihrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gw5B (B:)
    skyfttnkkgeifelkaelnnekkekrkeavkkviaamtvgkdvsslfpdvvncmqtdnl
    elkklvylylmnyaksqpdmaimavnsfvkdcedpnpliralavrtmgcirvdkiteylc
    eplrkclkdedpyvrktaavcvaklhdinaqmvedqgfldslrdliadsnpmvvanavaa
    lseiseshpnsnlldlnpqninklltalnectewgqifildclsnynpkddreaqsicer
    vtprlshansavvlsavkvlmkflellpkdsdyynmllkklapplvtllsgepevqyval
    rninlivqkrpeilkqeikvffvkyndpiyvklekldimirlasqaniaqvlaelkeyat
    evdvdfvrkavraigrcaikveqsaercvstlldliqtkvnyvvqeaivvirdifrkypn
    kyesiiatlcenldsldepdaraamiwivgeyaeridnadellesflegfhdestqvqlt
    lltaivklflkkpsetqelvqqvlsxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxieptlldelichigslasvyhkppnafv
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1gw5M (M:)
    migglfiynhkgevlisrvyrddigrnavdafrvnviharqqvrspvtniartsffhvkr
    sniwlaavtkqnvnaamvfeflykmcdvmaayfgkiseeniknnfvliyelldeildfgy
    pqnsetgalktfitqqgiksqhqtkeeqsqitsqvtgqigwrregikyrrnelfldvles
    vnllmspqgqvlsahvsgrvvmksylsgmpeckfgmndkiviekqgkgtadetsksgkqk
    iaiddctfhqcvrlskfdsersisfippdgefelmryrttkdiilpfrviplvrevgrtk
    levkvviksnfkpsllaqkievriptplntsgvqvicmkgkakykasenaivwkikrmag
    mkesqisaeiellptndkkkwarppismnfevpfapsglkvrylkvfepklnysdhdvik
    wvryigrsgiyetrc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gw5M (M:)
    migglfiynhkgevlisrvyrddigrnavdafrvnviharqqvrspvtniartsffhvkr
    sniwlaavtkqnvnaamvfeflykmcdvmaayfgkiseeniknnfvliyelldeildfgy
    pqnsetgalktfitqqgiksqigwrregikyrrnelfldvlesvnllmspqgqvlsahvs
    grvvmksylsgmpeckfgmndkivikiaiddctfhqcvrlsrsisfippdgefelmryrt
    tkdiilpfrviplvrevgrtklevkvviksnfkpsllaqkievriptplntsgvqvicmk
    gkakykasenaivwkikrmagmkesqisaeiellptndkkkwarppismnfevpfapsgl
    kvrylkvfepklnysdhdvikwvryigrsgiyetrc
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gw5S (S:)
    mirfiliqnragktrlakwymqfdddekqklieevhavvtvrdakhtnfvefrnfkiiyr
    ryaglyfcicvdvndnnlayleaihnfvevlneyfhnvceldlvfnfykvytvvdemfla
    geiretsqtkvlkqllmlqsle