PDB entry 1guy

View 1guy on RCSB PDB site
Description: structural basis for thermophilic protein stability: structures of thermophilic and mesophilic malate dehydrogenases
Deposited on 2002-02-04, released 2002-02-15
The last revision prior to the SCOP 1.67 freeze date was dated 2002-06-13, with a file datestamp of 2002-06-13.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.174
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1guyA (A:)
    mrkkisiigagfvgsttahwlaakelgdivlldivegvpqgkaldlyeaspiegfdvrvt
    gtnnyadtansdvivvtsgaprkpgmsredlikvnaditracisqaaplspnaviimvnn
    pldamtylaaevsgfpkervigqagvldaaryrtfiameagvsvedvqamlmgghgdemv
    plprfstisgipvsefiapdrlaqivertrkgggeivnllktgsayyapaaataqmveav
    lkdkkrvmpvaayltgqyglndiyfgvpvilgaggvekilelplneeemallnasakavr
    atldtlksl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1guyA (A:)
    mrkkisiigagfvgsttahwlaakelgdivlldivegvpqgkaldlyeaspiegfdvrvt
    gtnnyadtansdvivvtsgalikvnaditracisqaaplspnaviimvnnpldamtylaa
    evsgfpkervigqagvldaaryrtfiameagvsvedvqamlmgghgdemvplprfstisg
    ipvsefiapdrlaqivertrkgggeivnllktgsayyapaaataqmveavlkdkkrvmpv
    aayltgqyglndiyfgvpvilgaggvekilelplneeemallnasakavratldtl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1guyC (C:)
    mrkkisiigagfvgsttahwlaakelgdivlldivegvpqgkaldlyeaspiegfdvrvt
    gtnnyadtansdvivvtsgaprkpgmsredlikvnaditracisqaaplspnaviimvnn
    pldamtylaaevsgfpkervigqagvldaaryrtfiameagvsvedvqamlmgghgdemv
    plprfstisgipvsefiapdrlaqivertrkgggeivnllktgsayyapaaataqmveav
    lkdkkrvmpvaayltgqyglndiyfgvpvilgaggvekilelplneeemallnasakavr
    atldtlksl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1guyC (C:)
    mrkkisiigagfvgsttahwlaakelgdivlldivegvpqgkaldlyeaspiegfdvrvt
    gtnnyadtansdvivvtsgasredlikvnaditracisqaaplspnaviimvnnpldamt
    ylaaevsgfpkervigqagvldaaryrtfiameagvsvedvqamlmgghgdemvplprfs
    tisgipvsefiapdrlaqivertrkgggeivnllktgsayyapaaataqmveavlkdkkr
    vmpvaayltgqyglndiyfgvpvilgaggvekilelplneeemallnasakavratldtl