PDB entry 1gum

View 1gum on RCSB PDB site
Description: human glutathione transferase a4-4 without ligands
Deposited on 1998-06-11, released 1999-01-27
The last revision prior to the SCOP 1.61 freeze date was dated 2000-05-01, with a file datestamp of 2000-05-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.255
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gumA (A:)
    rpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmveidgm
    klvqtrsilhyiadkhnlfgknlkertlidmyvegtldllellimhpflkpddqqkevvn
    maqkaiiryfpvfekilrghgqsflvgnqlsladvillqtilaleekipnilsafpflqe
    ytvklsniptikrflepgskkkpppdeiyvrtvynif
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gumB (B:)
    rpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmveidgm
    klvqtrsilhyiadkhnlfgknlkertlidmyvegtldllellimhpflkpddqqkevvn
    maqkaiiryfpvfekilrghgqsflvgnqlsladvillqtilaleekipnilsafpflqe
    ytvklsniptikrflepgskkkpppdeiyvrtvynif
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gumC (C:)
    rpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmveidgm
    klvqtrsilhyiadkhnlfgknlkertlidmyvegtldllellimhpflkpddqqkevvn
    maqkaiiryfpvfekilrghgqsflvgnqlsladvillqtilaleekipnilsafpflqe
    ytvklsniptikrflepgskkkpppdeiyvrtvynif
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gumD (D:)
    rpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmveidgm
    klvqtrsilhyiadkhnlfgknlkertlidmyvegtldllellimhpflkpddqqkevvn
    maqkaiiryfpvfekilrghgqsflvgnqlsladvillqtilaleekipnilsafpflqe
    ytvklsniptikrflepgskkkpppdeiyvrtvynif
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gumE (E:)
    rpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmveidgm
    klvqtrsilhyiadkhnlfgknlkertlidmyvegtldllellimhpflkpddqqkevvn
    maqkaiiryfpvfekilrghgqsflvgnqlsladvillqtilaleekipnilsafpflqe
    ytvklsniptikrflepgskkkpppdeiyvrtvynif
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gumF (F:)
    rpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmveidgm
    klvqtrsilhyiadkhnlfgknlkertlidmyvegtldllellimhpflkpddqqkevvn
    maqkaiiryfpvfekilrghgqsflvgnqlsladvillqtilaleekipnilsafpflqe
    ytvklsniptikrflepgskkkpppdeiyvrtvynif
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gumG (G:)
    rpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmveidgm
    klvqtrsilhyiadkhnlfgknlkertlidmyvegtldllellimhpflkpddqqkevvn
    maqkaiiryfpvfekilrghgqsflvgnqlsladvillqtilaleekipnilsafpflqe
    ytvklsniptikrflepgskkkpppdeiyvrtvynif
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gumH (H:)
    rpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmveidgm
    klvqtrsilhyiadkhnlfgknlkertlidmyvegtldllellimhpflkpddqqkevvn
    maqkaiiryfpvfekilrghgqsflvgnqlsladvillqtilaleekipnilsafpflqe
    ytvklsniptikrflepgskkkpppdeiyvrtvynif