PDB entry 1gul

View 1gul on RCSB PDB site
Description: human glutathione transferase a4-4 complex with iodobenzyl glutathione
Deposited on 1998-06-10, released 1999-01-27
The last revision prior to the SCOP 1.61 freeze date was dated 2000-05-01, with a file datestamp of 2000-05-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.25
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gulA (A:)
    rpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmveidgm
    klvqtrsilhyiadkhnlfgknlkertlidmyvegtldllellimhpflkpddqqkevvn
    maqkaiiryfpvfekilrghgqsflvgnqlsladvillqtilaleekipnilsafpflqe
    ytvklsniptikrflepgskkkpppdeiyvrtvynif
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gulB (B:)
    rpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmveidgm
    klvqtrsilhyiadkhnlfgknlkertlidmyvegtldllellimhpflkpddqqkevvn
    maqkaiiryfpvfekilrghgqsflvgnqlsladvillqtilaleekipnilsafpflqe
    ytvklsniptikrflepgskkkpppdeiyvrtvynif
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gulC (C:)
    rpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmveidgm
    klvqtrsilhyiadkhnlfgknlkertlidmyvegtldllellimhpflkpddqqkevvn
    maqkaiiryfpvfekilrghgqsflvgnqlsladvillqtilaleekipnilsafpflqe
    ytvklsniptikrflepgskkkpppdeiyvrtvynif
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gulD (D:)
    rpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmveidgm
    klvqtrsilhyiadkhnlfgknlkertlidmyvegtldllellimhpflkpddqqkevvn
    maqkaiiryfpvfekilrghgqsflvgnqlsladvillqtilaleekipnilsafpflqe
    ytvklsniptikrflepgskkkpppdeiyvrtvynif
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gulE (E:)
    rpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmveidgm
    klvqtrsilhyiadkhnlfgknlkertlidmyvegtldllellimhpflkpddqqkevvn
    maqkaiiryfpvfekilrghgqsflvgnqlsladvillqtilaleekipnilsafpflqe
    ytvklsniptikrflepgskkkpppdeiyvrtvynif
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gulF (F:)
    rpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmveidgm
    klvqtrsilhyiadkhnlfgknlkertlidmyvegtldllellimhpflkpddqqkevvn
    maqkaiiryfpvfekilrghgqsflvgnqlsladvillqtilaleekipnilsafpflqe
    ytvklsniptikrflepgskkkpppdeiyvrtvynif
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gulG (G:)
    rpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmveidgm
    klvqtrsilhyiadkhnlfgknlkertlidmyvegtldllellimhpflkpddqqkevvn
    maqkaiiryfpvfekilrghgqsflvgnqlsladvillqtilaleekipnilsafpflqe
    ytvklsniptikrflepgskkkpppdeiyvrtvynif
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gulH (H:)
    rpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmveidgm
    klvqtrsilhyiadkhnlfgknlkertlidmyvegtldllellimhpflkpddqqkevvn
    maqkaiiryfpvfekilrghgqsflvgnqlsladvillqtilaleekipnilsafpflqe
    ytvklsniptikrflepgskkkpppdeiyvrtvynif