PDB entry 1guk

View 1guk on RCSB PDB site
Description: crystal structure of murine alpha-class gsta4-4
Deposited on 1997-12-11, released 1998-04-08
The last revision prior to the SCOP 1.61 freeze date was dated 1998-04-08, with a file datestamp of 1998-04-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.234
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gukA (A:)
    pklyyfngrgrmesirwllaaagvefeeefletreqyekmqkdghllfgqvplveidgmm
    ltqtrailsylaakynlygkdlkervridmyadgtqdlmmmiavapfktpkekeesydli
    lsraktryfpvfekilkdhgeaflvgnqlswadiqlleailmveelsapvlsdfpllqaf
    ktrisniptikkflqpgsqrkpppdgpyvevvriv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gukB (B:)
    pklyyfngrgrmesirwllaaagvefeeefletreqyekmqkdghllfgqvplveidgmm
    ltqtrailsylaakynlygkdlkervridmyadgtqdlmmmiavapfktpkekeesydli
    lsraktryfpvfekilkdhgeaflvgnqlswadiqlleailmveelsapvlsdfpllqaf
    ktrisniptikkflqpgsqrkpppdgpyvevvriv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gukB (B:)
    pklyyfngrgrmesirwllaaagvefeeefletreqyekmqkdghllfgqvplveidgmm
    ltqtrailsylaakynlygkdlkervridmyadgtqdlmmmiavapfktsydlilsrakt
    ryfpvfekilkdhgeaflvgnqlswadiqlleailmveelsapvlsdfpllqafktrisn
    iptikkflqpgsqrkpppdgpyvevvriv