PDB entry 1gtx

View 1gtx on RCSB PDB site
Description: 4-aminobutyrate-aminotransferase from pig
Deposited on 1999-02-04, released 2000-02-04
The last revision prior to the SCOP 1.65 freeze date was dated 2000-02-04, with a file datestamp of 2000-02-04.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.186
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1gtxa_
  • Chain 'B':
    Domains in SCOP 1.65: d1gtxb_
  • Chain 'C':
    Domains in SCOP 1.65: d1gtxc_
  • Chain 'D':
    Domains in SCOP 1.65: d1gtxd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gtxA (A:)
    sqaaakvdvefdydgplmktevpgprsrelmkqlniiqnaeavhffcnyeesrgnylvdv
    dgnrmldlysqissipigyshpalvklvqqpqnvstfinrpalgilppenfveklresll
    svapkgmsqlitmacgscsnenafktifmwyrskergqsafskeeletcminqapgcpdy
    silsfmgafhgrtmgclatthskaihkidipsfdwpiapfprlkypleefvkenqqeear
    cleevedlivkyrkkkktvagiivepiqseggdnhasddffrklrdisrkhgcaflvdev
    qtgggstgkfwahehwglddaadvmtfskkmmtggffhkeefrpnapyrifntwlgdpsk
    nlllaeviniikredllsnaahagkvlltglldlqarypqfisrvrgrgtfcsfdtpdes
    irnklisiarnkgvmlggcgdksirfrptlvfrdhhahlflnifsdiladfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gtxA (A:)
    fdydgplmktevpgprsrelmkqlniiqnaeavhffcnyeesrgnylvdvdgnrmldlys
    qissipigyshpalvklvqqpqnvstfinrpalgilppenfveklresllsvapkgmsql
    itmacgscsnenafktifmwyrskergqsafskeeletcminqapgcpdysilsfmgafh
    grtmgclatthskaihkidipsfdwpiapfprlkypleefvkenqqeearcleevedliv
    kyrkkkktvagiivepiqseggdnhasddffrklrdisrkhgcaflvdevqtgggstgkf
    wahehwglddaadvmtfskkmmtggffhkeefrpnapyrifntwlgdpsknlllaevini
    ikredllsnaahagkvlltglldlqarypqfisrvrgrgtfcsfdtpdesirnklisiar
    nkgvmlggcgdksirfrptlvfrdhhahlflnifsdiladfk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gtxB (B:)
    sqaaakvdvefdydgplmktevpgprsrelmkqlniiqnaeavhffcnyeesrgnylvdv
    dgnrmldlysqissipigyshpalvklvqqpqnvstfinrpalgilppenfveklresll
    svapkgmsqlitmacgscsnenafktifmwyrskergqsafskeeletcminqapgcpdy
    silsfmgafhgrtmgclatthskaihkidipsfdwpiapfprlkypleefvkenqqeear
    cleevedlivkyrkkkktvagiivepiqseggdnhasddffrklrdisrkhgcaflvdev
    qtgggstgkfwahehwglddaadvmtfskkmmtggffhkeefrpnapyrifntwlgdpsk
    nlllaeviniikredllsnaahagkvlltglldlqarypqfisrvrgrgtfcsfdtpdes
    irnklisiarnkgvmlggcgdksirfrptlvfrdhhahlflnifsdiladfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gtxB (B:)
    fdydgplmktevpgprsrelmkqlniiqnaeavhffcnyeesrgnylvdvdgnrmldlys
    qissipigyshpalvklvqqpqnvstfinrpalgilppenfveklresllsvapkgmsql
    itmacgscsnenafktifmwyrskergqsafskeeletcminqapgcpdysilsfmgafh
    grtmgclatthskaihkidipsfdwpiapfprlkypleefvkenqqeearcleevedliv
    kyrkkkktvagiivepiqseggdnhasddffrklrdisrkhgcaflvdevqtgggstgkf
    wahehwglddaadvmtfskkmmtggffhkeefrpnapyrifntwlgdpsknlllaevini
    ikredllsnaahagkvlltglldlqarypqfisrvrgrgtfcsfdtpdesirnklisiar
    nkgvmlggcgdksirfrptlvfrdhhahlflnifsdiladfk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1gtxC (C:)
    sqaaakvdvefdydgplmktevpgprsrelmkqlniiqnaeavhffcnyeesrgnylvdv
    dgnrmldlysqissipigyshpalvklvqqpqnvstfinrpalgilppenfveklresll
    svapkgmsqlitmacgscsnenafktifmwyrskergqsafskeeletcminqapgcpdy
    silsfmgafhgrtmgclatthskaihkidipsfdwpiapfprlkypleefvkenqqeear
    cleevedlivkyrkkkktvagiivepiqseggdnhasddffrklrdisrkhgcaflvdev
    qtgggstgkfwahehwglddaadvmtfskkmmtggffhkeefrpnapyrifntwlgdpsk
    nlllaeviniikredllsnaahagkvlltglldlqarypqfisrvrgrgtfcsfdtpdes
    irnklisiarnkgvmlggcgdksirfrptlvfrdhhahlflnifsdiladfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gtxC (C:)
    fdydgplmktevpgprsrelmkqlniiqnaeavhffcnyeesrgnylvdvdgnrmldlys
    qissipigyshpalvklvqqpqnvstfinrpalgilppenfveklresllsvapkgmsql
    itmacgscsnenafktifmwyrskergqsafskeeletcminqapgcpdysilsfmgafh
    grtmgclatthskaihkidipsfdwpiapfprlkypleefvkenqqeearcleevedliv
    kyrkkkktvagiivepiqseggdnhasddffrklrdisrkhgcaflvdevqtgggstgkf
    wahehwglddaadvmtfskkmmtggffhkeefrpnapyrifntwlgdpsknlllaevini
    ikredllsnaahagkvlltglldlqarypqfisrvrgrgtfcsfdtpdesirnklisiar
    nkgvmlggcgdksirfrptlvfrdhhahlflnifsdiladfk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1gtxD (D:)
    sqaaakvdvefdydgplmktevpgprsrelmkqlniiqnaeavhffcnyeesrgnylvdv
    dgnrmldlysqissipigyshpalvklvqqpqnvstfinrpalgilppenfveklresll
    svapkgmsqlitmacgscsnenafktifmwyrskergqsafskeeletcminqapgcpdy
    silsfmgafhgrtmgclatthskaihkidipsfdwpiapfprlkypleefvkenqqeear
    cleevedlivkyrkkkktvagiivepiqseggdnhasddffrklrdisrkhgcaflvdev
    qtgggstgkfwahehwglddaadvmtfskkmmtggffhkeefrpnapyrifntwlgdpsk
    nlllaeviniikredllsnaahagkvlltglldlqarypqfisrvrgrgtfcsfdtpdes
    irnklisiarnkgvmlggcgdksirfrptlvfrdhhahlflnifsdiladfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gtxD (D:)
    fdydgplmktevpgprsrelmkqlniiqnaeavhffcnyeesrgnylvdvdgnrmldlys
    qissipigyshpalvklvqqpqnvstfinrpalgilppenfveklresllsvapkgmsql
    itmacgscsnenafktifmwyrskergqsafskeeletcminqapgcpdysilsfmgafh
    grtmgclatthskaihkidipsfdwpiapfprlkypleefvkenqqeearcleevedliv
    kyrkkkktvagiivepiqseggdnhasddffrklrdisrkhgcaflvdevqtgggstgkf
    wahehwglddaadvmtfskkmmtggffhkeefrpnapyrifntwlgdpsknlllaevini
    ikredllsnaahagkvlltglldlqarypqfisrvrgrgtfcsfdtpdesirnklisiar
    nkgvmlggcgdksirfrptlvfrdhhahlflnifsdiladfk