PDB entry 1gtt

View 1gtt on RCSB PDB site
Description: crystal structure of hpce
Class: isomerase
Keywords: isomerase, lyase, bifunctional enzyme, multifunctional enzyme decarboxylase, aromatic hydrocarbons catabolism,
Deposited on 2002-01-18, released 2002-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.217
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-hydroxyphenylacetate degradation bifunctional isomerase/decarboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gtta1, d1gtta2
  • Chain 'B':
    Compound: 4-hydroxyphenylacetate degradation bifunctional isomerase/decarboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gttb1, d1gttb2
  • Chain 'C':
    Compound: 4-hydroxyphenylacetate degradation bifunctional isomerase/decarboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gttc1, d1gttc2
  • Chain 'D':
    Compound: 4-hydroxyphenylacetate degradation bifunctional isomerase/decarboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gttd1, d1gttd2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gttA (A:)
    mkgtifavalnhrsqldawqeafqqspykappktavwfikprntvigcgepipfpqgekv
    lsgatvalivgktatkvreedaaeyiagyalandvslpeesfyrpaikakcrdgfcpige
    tvalsnvdnltiyteingrpadhwntadlqrnaaqllsalsefatlnpgdaillgtpqar
    veiqpgdrvrvlaegfpplenpvvderevttrksfptlphphgtlfalglnyadhasele
    fkppeeplvflkapntltgdnqtsvrpnnieymhyeaelvvvigkqarnvseadamdyva
    gytvcndyairdylenyyrpnlrvksrdgltpmlstivpkeaipdphnltlrtfvngelr
    qqgttadlifsvpfliaylsefmtlnpgdmiatgtpkglsdvvpgdevvvevegvgrlvn
    rivseetak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gttA (A:)
    mkgtifavalnhrsqldawqeafqqspykappktavwfikprntvigcgepipfpqgekv
    lsgatvalivgktatkvreedaaeyiagyalandvslpeesfyrpaikakcrdgfcpige
    tvalsnvdnltiyteingrpadhwntadlqrnaaqllsalsefatlnpgdaillgtpqar
    veiqpgdrvrvlaegfpplenpvvderevttrksfptlphphgtlfalglnyadhpeepl
    vflkapntltgdnqtsvrpnnieymhyeaelvvvigkqarnvseadamdyvagytvcndy
    airdylenyyrpnlrvksrdgltpmlstivpkeaipdphnltlrtfvngelrqqgttadl
    ifsvpfliaylsefmtlnpgdmiatgtpkglsdvvpgdevvvevegvgrlvnrivseeta
    k
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gttB (B:)
    mkgtifavalnhrsqldawqeafqqspykappktavwfikprntvigcgepipfpqgekv
    lsgatvalivgktatkvreedaaeyiagyalandvslpeesfyrpaikakcrdgfcpige
    tvalsnvdnltiyteingrpadhwntadlqrnaaqllsalsefatlnpgdaillgtpqar
    veiqpgdrvrvlaegfpplenpvvderevttrksfptlphphgtlfalglnyadhasele
    fkppeeplvflkapntltgdnqtsvrpnnieymhyeaelvvvigkqarnvseadamdyva
    gytvcndyairdylenyyrpnlrvksrdgltpmlstivpkeaipdphnltlrtfvngelr
    qqgttadlifsvpfliaylsefmtlnpgdmiatgtpkglsdvvpgdevvvevegvgrlvn
    rivseetak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gttB (B:)
    mkgtifavalnhrsqldawqeafqqspykappktavwfikprntvigcgepipfpqgekv
    lsgatvalivgktatkvreedaaeyiagyalandvslpeesfyrpaikakcrdgfcpige
    tvalsnvdnltiyteingrpadhwntadlqrnaaqllsalsefatlnpgdaillgtpqar
    veiqpgdrvrvlaegfpplenpvvderevttrksfptlphphgtlfalglnyadhpeepl
    vflkapntltgdnqtsvrpnnieymhyeaelvvvigkqarnvseadamdyvagytvcndy
    airdylenyyrpnlrvksrdgltpmlstivpkeaipdphnltlrtfvngelrqqgttadl
    ifsvpfliaylsefmtlnpgdmiatgtpkglsdvvpgdevvvevegvgrlvnrivseeta
    k
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1gttC (C:)
    mkgtifavalnhrsqldawqeafqqspykappktavwfikprntvigcgepipfpqgekv
    lsgatvalivgktatkvreedaaeyiagyalandvslpeesfyrpaikakcrdgfcpige
    tvalsnvdnltiyteingrpadhwntadlqrnaaqllsalsefatlnpgdaillgtpqar
    veiqpgdrvrvlaegfpplenpvvderevttrksfptlphphgtlfalglnyadhasele
    fkppeeplvflkapntltgdnqtsvrpnnieymhyeaelvvvigkqarnvseadamdyva
    gytvcndyairdylenyyrpnlrvksrdgltpmlstivpkeaipdphnltlrtfvngelr
    qqgttadlifsvpfliaylsefmtlnpgdmiatgtpkglsdvvpgdevvvevegvgrlvn
    rivseetak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gttC (C:)
    mkgtifavalnhrsqldawqeafqqspykappktavwfikprntvigcgepipfpqgekv
    lsgatvalivgktatkvreedaaeyiagyalandvslpeesfyrpaikakcrdgfcpige
    tvalsnvdnltiyteingrpadhwntadlqrnaaqllsalsefatlnpgdaillgtpqar
    veiqpgdrvrvlaegfpplenpvvderevttrksfptlphphgtlfalglnyadhpeepl
    vflkapntltgdnqtsvrpnnieymhyeaelvvvigkqarnvseadamdyvagytvcndy
    airdylenyyrpnlrvksrdgltpmlstivpkeaipdphnltlrtfvngelrqqgttadl
    ifsvpfliaylsefmtlnpgdmiatgtpkglsdvvpgdevvvevegvgrlvnrivseeta
    k
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1gttD (D:)
    mkgtifavalnhrsqldawqeafqqspykappktavwfikprntvigcgepipfpqgekv
    lsgatvalivgktatkvreedaaeyiagyalandvslpeesfyrpaikakcrdgfcpige
    tvalsnvdnltiyteingrpadhwntadlqrnaaqllsalsefatlnpgdaillgtpqar
    veiqpgdrvrvlaegfpplenpvvderevttrksfptlphphgtlfalglnyadhasele
    fkppeeplvflkapntltgdnqtsvrpnnieymhyeaelvvvigkqarnvseadamdyva
    gytvcndyairdylenyyrpnlrvksrdgltpmlstivpkeaipdphnltlrtfvngelr
    qqgttadlifsvpfliaylsefmtlnpgdmiatgtpkglsdvvpgdevvvevegvgrlvn
    rivseetak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gttD (D:)
    mkgtifavalnhrsqldawqeafqqspykappktavwfikprntvigcgepipfpqgekv
    lsgatvalivgktatkvreedaaeyiagyalandvslpeesfyrpaikakcrdgfcpige
    tvalsnvdnltiyteingrpadhwntadlqrnaaqllsalsefatlnpgdaillgtpqar
    veiqpgdrvrvlaegfpplenpvvderevttrksfptlphphgtlfalglnyadhpeepl
    vflkapntltgdnqtsvrpnnieymhyeaelvvvigkqarnvseadamdyvagytvcndy
    airdylenyyrpnlrvksrdgltpmlstivpkeaipdphnltlrtfvngelrqqgttadl
    ifsvpfliaylsefmtlnpgdmiatgtpkglsdvvpgdevvvevegvgrlvnrivseeta
    k