PDB entry 1gtm

View 1gtm on RCSB PDB site
Description: structure of glutamate dehydrogenase
Deposited on 1996-08-22, released 1997-01-11
The last revision prior to the SCOP 1.67 freeze date was dated 1997-01-11, with a file datestamp of 1997-01-13.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.174
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gtmA (A:)
    veadpyeivikqleraaqymeiseealeflkrpqrivevtipvemddgsvkvftgfrvqh
    nwargptkggirwhpeetlstvkalaawmtwktavmdlpygggkggiivdpkklsdreke
    rlargyiraiydvispyedipapdvytnpqimawmmdeyetisrrktpafgiitgkplsi
    ggslgrieatargasytireaakvlgwdtlkgktiaiqgygnagyylakimsedfgmkvv
    avsdskggiynpdglnadevlkwknehgsvkdfpgatnitneellelevdvlapaaieev
    itkknadnikakivaevangpvtpeadeilfekgilqipdflcnaggvtvsyfewvqnit
    gyywtieevrerldkkmtkafydvyniakeknihmrdaayvvavqrvyqamldrgwvkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gtmA (A:)
    adpyeivikqleraaqymeiseealeflkrpqrivevtipvemddgsvkvftgfrvqhnw
    argptkggirwhpeetlstvkalaawmtwktavmdlpygggkggiivdpkklsdrekerl
    argyiraiydvispyedipapdvytnpqimawmmdeyetisrrktpafgiitgkplsigg
    slgrieatargasytireaakvlgwdtlkgktiaiqgygnagyylakimsedfgmkvvav
    sdskggiynpdglnadevlkwknehgsvkdfpgatnitneellelevdvlapaaieevit
    kknadnikakivaevangpvtpeadeilfekgilqipdflcnaggvtvsyfewvqnitgy
    ywtieevrerldkkmtkafydvyniakeknihmrdaayvvavqrvyqamldrgwvkh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gtmB (B:)
    veadpyeivikqleraaqymeiseealeflkrpqrivevtipvemddgsvkvftgfrvqh
    nwargptkggirwhpeetlstvkalaawmtwktavmdlpygggkggiivdpkklsdreke
    rlargyiraiydvispyedipapdvytnpqimawmmdeyetisrrktpafgiitgkplsi
    ggslgrieatargasytireaakvlgwdtlkgktiaiqgygnagyylakimsedfgmkvv
    avsdskggiynpdglnadevlkwknehgsvkdfpgatnitneellelevdvlapaaieev
    itkknadnikakivaevangpvtpeadeilfekgilqipdflcnaggvtvsyfewvqnit
    gyywtieevrerldkkmtkafydvyniakeknihmrdaayvvavqrvyqamldrgwvkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gtmB (B:)
    adpyeivikqleraaqymeiseealeflkrpqrivevtipvemddgsvkvftgfrvqhnw
    argptkggirwhpeetlstvkalaawmtwktavmdlpygggkggiivdpkklsdrekerl
    argyiraiydvispyedipapdvytnpqimawmmdeyetisrrktpafgiitgkplsigg
    slgrieatargasytireaakvlgwdtlkgktiaiqgygnagyylakimsedfgmkvvav
    sdskggiynpdglnadevlkwknehgsvkdfpgatnitneellelevdvlapaaieevit
    kknadnikakivaevangpvtpeadeilfekgilqipdflcnaggvtvsyfewvqnitgy
    ywtieevrerldkkmtkafydvyniakeknihmrdaayvvavqrvyqamldrgwvkh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1gtmC (C:)
    veadpyeivikqleraaqymeiseealeflkrpqrivevtipvemddgsvkvftgfrvqh
    nwargptkggirwhpeetlstvkalaawmtwktavmdlpygggkggiivdpkklsdreke
    rlargyiraiydvispyedipapdvytnpqimawmmdeyetisrrktpafgiitgkplsi
    ggslgrieatargasytireaakvlgwdtlkgktiaiqgygnagyylakimsedfgmkvv
    avsdskggiynpdglnadevlkwknehgsvkdfpgatnitneellelevdvlapaaieev
    itkknadnikakivaevangpvtpeadeilfekgilqipdflcnaggvtvsyfewvqnit
    gyywtieevrerldkkmtkafydvyniakeknihmrdaayvvavqrvyqamldrgwvkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gtmC (C:)
    adpyeivikqleraaqymeiseealeflkrpqrivevtipvemddgsvkvftgfrvqhnw
    argptkggirwhpeetlstvkalaawmtwktavmdlpygggkggiivdpkklsdrekerl
    argyiraiydvispyedipapdvytnpqimawmmdeyetisrrktpafgiitgkplsigg
    slgrieatargasytireaakvlgwdtlkgktiaiqgygnagyylakimsedfgmkvvav
    sdskggiynpdglnadevlkwknehgsvkdfpgatnitneellelevdvlapaaieevit
    kknadnikakivaevangpvtpeadeilfekgilqipdflcnaggvtvsyfewvqnitgy
    ywtieevrerldkkmtkafydvyniakeknihmrdaayvvavqrvyqamldrgwvkh