PDB entry 1gti

View 1gti on RCSB PDB site
Description: modified glutathione s-transferase (pi) complexed with s (p-nitrobenzyl)glutathione
Deposited on 1998-01-09, released 1999-03-02
The last revision prior to the SCOP 1.63 freeze date was dated 1999-03-02, with a file datestamp of 1999-03-02.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.246
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gtiA (A:)
    ppytivyfpvrgrceamrmlladqgqswkeevvtidtwmqgllkptclygqlpkfedgdl
    tlyqsnailrhlgrslglygknqreaaqmdmvndgvedlrgkyvtliytnyengkndyvk
    alpghlkpfetllsqnqggkafivgdqisfadynlldlllihqvlapgcldnfpllsayv
    arlsarpkikaflsspehvnrpingngkq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gtiB (B:)
    ppytivyfpvrgrceamrmlladqgqswkeevvtidtwmqgllkptclygqlpkfedgdl
    tlyqsnailrhlgrslglygknqreaaqmdmvndgvedlrgkyvtliytnyengkndyvk
    alpghlkpfetllsqnqggkafivgdqisfadynlldlllihqvlapgcldnfpllsayv
    arlsarpkikaflsspehvnrpingngkq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gtiC (C:)
    ppytivyfpvrgrceamrmlladqgqswkeevvtidtwmqgllkptclygqlpkfedgdl
    tlyqsnailrhlgrslglygknqreaaqmdmvndgvedlrgkyvtliytnyengkndyvk
    alpghlkpfetllsqnqggkafivgdqisfadynlldlllihqvlapgcldnfpllsayv
    arlsarpkikaflsspehvnrpingngkq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gtiD (D:)
    ppytivyfpvrgrceamrmlladqgqswkeevvtidtwmqgllkptclygqlpkfedgdl
    tlyqsnailrhlgrslglygknqreaaqmdmvndgvedlrgkyvtliytnyengkndyvk
    alpghlkpfetllsqnqggkafivgdqisfadynlldlllihqvlapgcldnfpllsayv
    arlsarpkikaflsspehvnrpingngkq
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gtiE (E:)
    ppytivyfpvrgrceamrmlladqgqswkeevvtidtwmqgllkptclygqlpkfedgdl
    tlyqsnailrhlgrslglygknqreaaqmdmvndgvedlrgkyvtliytnyengkndyvk
    alpghlkpfetllsqnqggkafivgdqisfadynlldlllihqvlapgcldnfpllsayv
    arlsarpkikaflsspehvnrpingngkq
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gtiF (F:)
    ppytivyfpvrgrceamrmlladqgqswkeevvtidtwmqgllkptclygqlpkfedgdl
    tlyqsnailrhlgrslglygknqreaaqmdmvndgvedlrgkyvtliytnyengkndyvk
    alpghlkpfetllsqnqggkafivgdqisfadynlldlllihqvlapgcldnfpllsayv
    arlsarpkikaflsspehvnrpingngkq