PDB entry 1gta

View 1gta on RCSB PDB site
Description: crystal structures of a schistosomal drug and vaccine target: glutathione s-transferase from schistosoma japonica and its complex with the leading antischistosomal drug praziquantel
Class: glutathione transferase
Keywords: glutathione transferase
Deposited on 1994-12-01, released 1995-02-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.197
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: glutathione s-transferase
  Species: Schistosoma japonicum [TaxId:6182]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08515 (0-217)
  Domains in SCOPe 2.04: d1gtaa1, d1gtaa2
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1gtaA (A:)
  mspilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyid
  gdvkltqsmaiiryiadkhnmlggcpkeraeismlegavldirygvsriayskdfetlkv
  dflsklpemlkmfedrlchktylngdhvthpdfmlydaldvvlymdpmcldafpklvcfk
  krieaipqidkylksskyiawplqgwqatfgggdhppk