PDB entry 1gsu

View 1gsu on RCSB PDB site
Description: an avian class-mu glutathione s-transferase, cgstm1-1 at 1.94 angstrom resolution
Deposited on 1997-09-02, released 1998-03-04
The last revision prior to the SCOP 1.61 freeze date was dated 1998-03-04, with a file datestamp of 1998-03-04.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.21
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gsuA (A:)
    vvtlgywdirglahairllleytetpyqerrykagpapdfdpsdwtnekeklgldfpnlp
    ylidgdvkltqsnailryiarkhnmcgetevekqrvdvlenhlmdlrmafarlcyspdfe
    klkpayleqlpgklrqlsrflgsrswfvgdkltfvdflaydvldqqrmfvpdcpelqgnl
    sqflqrfealekisaymrsgrfmkapifwytalwnnk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gsuB (B:)
    vvtlgywdirglahairllleytetpyqerrykagpapdfdpsdwtnekeklgldfpnlp
    ylidgdvkltqsnailryiarkhnmcgetevekqrvdvlenhlmdlrmafarlcyspdfe
    klkpayleqlpgklrqlsrflgsrswfvgdkltfvdflaydvldqqrmfvpdcpelqgnl
    sqflqrfealekisaymrsgrfmkapifwytalwnnk