PDB entry 1gsq

View 1gsq on RCSB PDB site
Description: three-dimensional structure, catalytic properties and evolution of a sigma class glutathione transferase from squid, a progenitor of the lens-crystallins of cephalopods
Class: transferase
Keywords: glutathione transferase, transferase
Deposited on 1995-01-09, released 1995-06-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.18
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase
    Species: Ommastrephes sloani pacificus [TaxId:6634]
    Gene: CDNA INSERT OF CLONE PGST5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gsqa1, d1gsqa2
  • Heterogens: GDN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gsqA (A:)
    pkytlhyfplmgraelcrfvlaahgeeftdrvvemadwpnlkatmysnampvldidgtkm
    sqsmciarhlarefgldgktslekyrvdeitetlqdifndvvkikfapeaakeavqqnye
    ksckrlapflegllvsngggdgffvgnsmtladlhcyvalevplkhtpellkdcpkival
    rkrvaecpkiaaylkkrpvrdf