PDB entry 1gqv

View 1gqv on RCSB PDB site
Description: atomic resolution (0.98a) structure of eosinophil-derived neurotoxin
Class: RNAse-2
Keywords: RNAse-2, RNAse us, ribonuclease
Deposited on 2001-12-05, released 2002-03-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 0.98 Å
R-factor: 0.1159
AEROSPACI score: 1.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: eosinophil-derived neurotoxin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10153 (0-134)
    • cloning artifact (0)
  Domains in SCOPe 2.05: d1gqva_
• Heterogens: ACT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1gqvA (A:)
  mkppqftwaqwfetqhinmtsqqctnamqvinnyqrrcknqntfllttfanvvnvcgnpn
  mtcpsnktrknchhsgsqvplihcnlttpspqnisncryaqtpanmfyivacdnrdqrrd
  ppqypvvpvhldrii