PDB entry 1gpz

View 1gpz on RCSB PDB site
Description: the crystal structure of the zymogen catalytic domain of complement protease c1r
Class: hydrolase
Keywords: hydrolase, activation, complement, innate immunity, modular structure, serine protease
Deposited on 2001-11-15, released 2002-07-31
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-09-28, with a file datestamp of 2011-09-23.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.242
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: complement c1r component
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00736 (0-End)
      • engineered mutation (156)
    Domains in SCOPe 2.01: d1gpza1, d1gpza2, d1gpza3
  • Chain 'B':
    Compound: complement c1r component
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00736 (0-End)
      • engineered mutation (156)
    Domains in SCOPe 2.01: d1gpzb1, d1gpzb2, d1gpzb3
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gpzA (A:)
    ikcpqpktldeftiiqnlqpqyqfrdyfiatckqgyqliegnqvlhsftavcqddgtwhr
    amprckikdcgqprnlpngdfrytttmgvntykariqyychepyykmqtragsreseqgv
    ytctaqgiwkneqkgekiprclpvcgkpvnpveqrqqiiggqkakmgnfpwqvftnihgr
    gggallgdrwiltaahtlypkeheaqsnasldvflghtnveelmklgnhpirrvsvhpdy
    rqdesynfegdiallelensvtlgpnllpiclpdndtfydlglmgyvsgfgvmeekiahd
    lrfvrlpvanpqacenwlrgknrmdvfsqnmfcaghpslkqdacqgdsggvfavrdpntd
    rwvatgivswgigcsrgygfytkvlnyvdwikkemeeed
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gpzA (A:)
    ikcpqpktldeftiiqnlqpqyqfrdyfiatckqgyqliegnqvlhsftavcqddgtwhr
    amprckikdcgqprnlpngdfrytttmgvntykariqyychepyykmqteqgvytctaqg
    iwkneqkgekiprclpvcgkpvnpveqrqqiiggqkakmgnfpwqvftnihgrgggallg
    drwiltaahtlypkehasldvflghtnveelmklgnhpirrvsvhpdyrqdesynfegdi
    allelensvtlgpnllpiclpdndtfydlglmgyvsgfgiahdlrfvrlpvanpqacens
    qnmfcaghpslkqdacqgdsggvfavrdpntdrwvatgivswgigcsrgygfytkvlnyv
    dwikkemee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gpzB (B:)
    ikcpqpktldeftiiqnlqpqyqfrdyfiatckqgyqliegnqvlhsftavcqddgtwhr
    amprckikdcgqprnlpngdfrytttmgvntykariqyychepyykmqtragsreseqgv
    ytctaqgiwkneqkgekiprclpvcgkpvnpveqrqqiiggqkakmgnfpwqvftnihgr
    gggallgdrwiltaahtlypkeheaqsnasldvflghtnveelmklgnhpirrvsvhpdy
    rqdesynfegdiallelensvtlgpnllpiclpdndtfydlglmgyvsgfgvmeekiahd
    lrfvrlpvanpqacenwlrgknrmdvfsqnmfcaghpslkqdacqgdsggvfavrdpntd
    rwvatgivswgigcsrgygfytkvlnyvdwikkemeeed
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gpzB (B:)
    ikcpqpktldeftiiqnlqpqyqfrdyfiatckqgyqliegnqvlhsftavcqddgtwhr
    amprckikdcgqprnlpngdfrytttmgvntykariqyychepyykmqtgvytctaqgiw
    kneqkgekiprclpvcgkpvnpveqrqqiiggqkakmgnfpwqvftnihgrgggallgdr
    wiltaahtlypkehqsnasldvflghtnveelmklgnhpirrvsvhpdyrqdesynfegd
    iallelensvtlgpnllpiclpdndtfydlglmgyvsgfgiahdlrfvrlpvanpqaceq
    nmfcaghpslkqdacqgdsggvfavrdpntdrwvatgivswgigcsrgygfytkvlnyvd
    wikkemee