PDB entry 1gpz

View 1gpz on RCSB PDB site
Description: the crystal structure of the zymogen catalytic domain of complement protease c1r
Deposited on 2001-11-15, released 2002-07-31
The last revision prior to the SCOP 1.61 freeze date was dated 2002-07-31, with a file datestamp of 2002-07-31.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.242
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gpzA (A:)
    ikcpqpktldeftiiqnlqpqyqfrdyfiatckqgyqliegnqvlhsftavcqddgtwhr
    amprckikdcgqprnlpngdfrytttmgvntykariqyychepyykmqtragsreseqgv
    ytctaqgiwkneqkgekiprclpvcgkpvnpveqrqqiiggqkakmgnfpwqvftnihgr
    gggallgdrwiltaahtlypkeheaqsnasldvflghtnveelmklgnhpirrvsvhpdy
    rqdesynfegdiallelensvtlgpnllpiclpdndtfydlglmgyvsgfgvmeekiahd
    lrfvrlpvanpqacenwlrgknrmdvfsqnmfcaghpslkqdacqgdsggvfavrdpntd
    rwvatgivswgigcsrgygfytkvlnyvdwikkeme
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gpzA (A:)
    ikcpqpktldeftiiqnlqpqyqfrdyfiatckqgyqliegnqvlhsftavcqddgtwhr
    amprckikdcgqprnlpngdfrytttmgvntykariqyychepyykmqteqgvytctaqg
    iwkneqkgekiprclpvcgkpvnpveqrqqiiggqkakmgnfpwqvftnihgrgggallg
    drwiltaahtlypkehasldvflghtnveelmklgnhpirrvsvhpdyrqdesynfegdi
    allelensvtlgpnllpiclpdndtfydlglmgyvsgfgiahdlrfvrlpvanpqacens
    qnmfcaghpslkqdacqgdsggvfavrdpntdrwvatgivswgigcsrgygfytkvlnyv
    dwikkeme
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gpzB (B:)
    ikcpqpktldeftiiqnlqpqyqfrdyfiatckqgyqliegnqvlhsftavcqddgtwhr
    amprckikdcgqprnlpngdfrytttmgvntykariqyychepyykmqtragsreseqgv
    ytctaqgiwkneqkgekiprclpvcgkpvnpveqrqqiiggqkakmgnfpwqvftnihgr
    gggallgdrwiltaahtlypkeheaqsnasldvflghtnveelmklgnhpirrvsvhpdy
    rqdesynfegdiallelensvtlgpnllpiclpdndtfydlglmgyvsgfgvmeekiahd
    lrfvrlpvanpqacenwlrgknrmdvfsqnmfcaghpslkqdacqgdsggvfavrdpntd
    rwvatgivswgigcsrgygfytkvlnyvdwikkeme
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gpzB (B:)
    ikcpqpktldeftiiqnlqpqyqfrdyfiatckqgyqliegnqvlhsftavcqddgtwhr
    amprckikdcgqprnlpngdfrytttmgvntykariqyychepyykmqtgvytctaqgiw
    kneqkgekiprclpvcgkpvnpveqrqqiiggqkakmgnfpwqvftnihgrgggallgdr
    wiltaahtlypkehqsnasldvflghtnveelmklgnhpirrvsvhpdyrqdesynfegd
    iallelensvtlgpnllpiclpdndtfydlglmgyvsgfgiahdlrfvrlpvanpqaceq
    nmfcaghpslkqdacqgdsggvfavrdpntdrwvatgivswgigcsrgygfytkvlnyvd
    wikkeme