PDB entry 1gpu

View 1gpu on RCSB PDB site
Description: transketolase complex with reaction intermediate
Deposited on 2001-11-09, released 2002-02-11
The last revision prior to the SCOP 1.59 freeze date was dated 2002-02-11, with a file datestamp of 2002-02-11.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.198
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gpuA (A:)
    qftdidklavstirilavdtvskansghpgaplgmapaahvlwsqmrmnptnpdwinrdr
    fvlsnghavallysmlhltgydlsiedlkqfrqlgsrtpghpefelpgvevttgplgqgi
    snavgmamaqanlaatynkpgftlsdnytyvflgdgclqegisseasslaghlklgnlia
    iyddnkitidgatsisfdedvakryeaygwevlyvengnedlagiakaiaqaklskdkpt
    likmtttigygslhagshsvhgaplkaddvkqlkskfgfnpdksfvvpqevydhyqktil
    kpgveannkwnklfseyqkkfpelgaelarrlsgqlpanwesklptytakdsavatrkls
    etvledvynqlpeliggsadltpsnltrwkealdfqppssgsgnysgryirygirehamg
    aimngisafganykpyggtflnfvsyaagavrlsalsghpviwvathdsigvgedgpthq
    pietlahfrslpniqvwrpadgnevsaayknsleskhtpsiialsrqnlpqlegssiesa
    skggyvlqdvanpdiilvatgsevslsveaaktlaaknikarvvslpdfftfdkqpleyr
    lsvlpdnvpimsvevlattcwgkyahqsfgidrfgasgkapevfkffgftpegvaeraqk
    tiafykgdklisplkkaf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gpuB (B:)
    qftdidklavstirilavdtvskansghpgaplgmapaahvlwsqmrmnptnpdwinrdr
    fvlsnghavallysmlhltgydlsiedlkqfrqlgsrtpghpefelpgvevttgplgqgi
    snavgmamaqanlaatynkpgftlsdnytyvflgdgclqegisseasslaghlklgnlia
    iyddnkitidgatsisfdedvakryeaygwevlyvengnedlagiakaiaqaklskdkpt
    likmtttigygslhagshsvhgaplkaddvkqlkskfgfnpdksfvvpqevydhyqktil
    kpgveannkwnklfseyqkkfpelgaelarrlsgqlpanwesklptytakdsavatrkls
    etvledvynqlpeliggsadltpsnltrwkealdfqppssgsgnysgryirygirehamg
    aimngisafganykpyggtflnfvsyaagavrlsalsghpviwvathdsigvgedgpthq
    pietlahfrslpniqvwrpadgnevsaayknsleskhtpsiialsrqnlpqlegssiesa
    skggyvlqdvanpdiilvatgsevslsveaaktlaaknikarvvslpdfftfdkqpleyr
    lsvlpdnvpimsvevlattcwgkyahqsfgidrfgasgkapevfkffgftpegvaeraqk
    tiafykgdklisplkkaf