PDB entry 1gpm

View 1gpm on RCSB PDB site
Description: escherichia coli gmp synthetase complexed with amp and pyrophosphate
Deposited on 1995-04-04, released 1996-01-29
The last revision prior to the SCOP 1.65 freeze date was dated 1996-01-29, with a file datestamp of 1996-01-31.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.174
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gpmA (A:)
    mtenihkhrilildfgsqytqlvarrvrelgvycelwawdvteaqirdfnpsgiilsggp
    estteensprapqyvfeagvpvfgvcygmqtmamqlgghveasnerefgyaqvevvndsa
    lvrgiedaltadgkplldvwmshgdkvtaipsdfitvastescpfaimaneekrfygvqf
    hpevthtrqgmrmlerfvrdicqcealwtpakiiddavarireqvgddkvilglsggvds
    svtamllhraigknltcvfvdngllrlneaeqvldmfgdhfglnivhvpaedrflsalag
    endpeakrkiigrvfvevfdeealkledvkwlaqgtiypdviesaasatgkahvikshhn
    vgglpkemkmglveplkelfkdevrkiglelglpydmlyrhpfpgpglgvrvlgevkkey
    cdllrradaifieelrkadlydkvsqaftvflpvrsvgvmgdgrkydwvvslravetidf
    mtahwahlpydflgrvsnriinevngisrvvydisgkppatiewe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gpmA (A:)
    enihkhrilildfgsqytqlvarrvrelgvycelwawdvteaqirdfnpsgiilsggpes
    tteensprapqyvfeagvpvfgvcygmqtmamqlgghveasnerefgyaqvevvndsalv
    rgiedaltadgkplldvwmshgdkvtaipsdfitvastescpfaimaneekrfygvqfhp
    evthtrqgmrmlerfvrdicqcealwtpakiiddavarireqvgddkvilglsggvdssv
    tamllhraigknltcvfvdngllrlneaeqvldmfgdhfglnivhvpaedrflsalagen
    dpeakrkiigrvfvevfdeealkledvkwlaqgtiypdviesaakmglveplkelfkdev
    rkiglelglpydmlyrhpfpgpglgvrvlgevkkeycdllrradaifieelrkadlydkv
    sqaftvflpvrsvgvmgdgrkydwvvslravetidfmtahwahlpydflgrvsnriinev
    ngisrvvydisgkppatiewe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gpmB (B:)
    mtenihkhrilildfgsqytqlvarrvrelgvycelwawdvteaqirdfnpsgiilsggp
    estteensprapqyvfeagvpvfgvcygmqtmamqlgghveasnerefgyaqvevvndsa
    lvrgiedaltadgkplldvwmshgdkvtaipsdfitvastescpfaimaneekrfygvqf
    hpevthtrqgmrmlerfvrdicqcealwtpakiiddavarireqvgddkvilglsggvds
    svtamllhraigknltcvfvdngllrlneaeqvldmfgdhfglnivhvpaedrflsalag
    endpeakrkiigrvfvevfdeealkledvkwlaqgtiypdviesaasatgkahvikshhn
    vgglpkemkmglveplkelfkdevrkiglelglpydmlyrhpfpgpglgvrvlgevkkey
    cdllrradaifieelrkadlydkvsqaftvflpvrsvgvmgdgrkydwvvslravetidf
    mtahwahlpydflgrvsnriinevngisrvvydisgkppatiewe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gpmB (B:)
    enihkhrilildfgsqytqlvarrvrelgvycelwawdvteaqirdfnpsgiilsggpes
    tteensprapqyvfeagvpvfgvcygmqtmamqlgghveasnerefgyaqvevvndsalv
    rgiedaltadgkplldvwmshgdkvtaipsdfitvastescpfaimaneekrfygvqfhp
    evthtrqgmrmlerfvrdicqcealwtpakiiddavarireqvgddkvilglsggvdssv
    tamllhraigknltcvfvdngllrlneaeqvldmfgdhfglnivhvpaedrflsalagen
    dpeakrkiigrvfvevfdeealkledvkwlaqgtiypdviemkmglveplkelfkdevrk
    iglelglpydmlyrhpfpgpglgvrvlgevkkeycdllrradaifieelrkadlydkvsq
    aftvflpvrsvgvmgdgrkydwvvslravetidfmtahwahlpydflgrvsnriinevng
    isrvvydisgkppatiewe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1gpmC (C:)
    mtenihkhrilildfgsqytqlvarrvrelgvycelwawdvteaqirdfnpsgiilsggp
    estteensprapqyvfeagvpvfgvcygmqtmamqlgghveasnerefgyaqvevvndsa
    lvrgiedaltadgkplldvwmshgdkvtaipsdfitvastescpfaimaneekrfygvqf
    hpevthtrqgmrmlerfvrdicqcealwtpakiiddavarireqvgddkvilglsggvds
    svtamllhraigknltcvfvdngllrlneaeqvldmfgdhfglnivhvpaedrflsalag
    endpeakrkiigrvfvevfdeealkledvkwlaqgtiypdviesaasatgkahvikshhn
    vgglpkemkmglveplkelfkdevrkiglelglpydmlyrhpfpgpglgvrvlgevkkey
    cdllrradaifieelrkadlydkvsqaftvflpvrsvgvmgdgrkydwvvslravetidf
    mtahwahlpydflgrvsnriinevngisrvvydisgkppatiewe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gpmC (C:)
    enihkhrilildfgsqytqlvarrvrelgvycelwawdvteaqirdfnpsgiilsggpes
    tteensprapqyvfeagvpvfgvcygmqtmamqlgghveasnerefgyaqvevvndsalv
    rgiedaltadgkplldvwmshgdkvtaipsdfitvastescpfaimaneekrfygvqfhp
    evthtrqgmrmlerfvrdicqcealwtpakiiddavarireqvgddkvilglsggvdssv
    tamllhraigknltcvfvdngllrlneaeqvldmfgdhfglnivhvpaedrflsalagen
    dpeakrkiigrvfvevfdeealkledvkwlaqgtiypdviesaakmglveplkelfkdev
    rkiglelglpydmlyrhpfpgpglgvrvlgevkkeycdllrradaifieelrkadlydkv
    sqaftvflpvrsvgvmgdgrkydwvvslravetidfmtahwahlpydflgrvsnriinev
    ngisrvvydisgkppatiewe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1gpmD (D:)
    mtenihkhrilildfgsqytqlvarrvrelgvycelwawdvteaqirdfnpsgiilsggp
    estteensprapqyvfeagvpvfgvcygmqtmamqlgghveasnerefgyaqvevvndsa
    lvrgiedaltadgkplldvwmshgdkvtaipsdfitvastescpfaimaneekrfygvqf
    hpevthtrqgmrmlerfvrdicqcealwtpakiiddavarireqvgddkvilglsggvds
    svtamllhraigknltcvfvdngllrlneaeqvldmfgdhfglnivhvpaedrflsalag
    endpeakrkiigrvfvevfdeealkledvkwlaqgtiypdviesaasatgkahvikshhn
    vgglpkemkmglveplkelfkdevrkiglelglpydmlyrhpfpgpglgvrvlgevkkey
    cdllrradaifieelrkadlydkvsqaftvflpvrsvgvmgdgrkydwvvslravetidf
    mtahwahlpydflgrvsnriinevngisrvvydisgkppatiewe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gpmD (D:)
    enihkhrilildfgsqytqlvarrvrelgvycelwawdvteaqirdfnpsgiilsggpes
    tteensprapqyvfeagvpvfgvcygmqtmamqlgghveasnerefgyaqvevvndsalv
    rgiedaltadgkplldvwmshgdkvtaipsdfitvastescpfaimaneekrfygvqfhp
    evthtrqgmrmlerfvrdicqcealwtpakiiddavarireqvgddkvilglsggvdssv
    tamllhraigknltcvfvdngllrlneaeqvldmfgdhfglnivhvpaedrflsalagen
    dpeakrkiigrvfvevfdeealkledvkwlaqgtiypdviemkmglveplkelfkdevrk
    iglelglpydmlyrhpfpgpglgvrvlgevkkeycdllrradaifieelrkadlydkvsq
    aftvflpvrsvgvmgdgrkydwvvslravetidfmtahwahlpydflgrvsnriinevng
    isrvvydisgkppatiewe