PDB entry 1goz

View 1goz on RCSB PDB site
Description: structural basis for the altered T-cell receptor binding specificty in a superantigenic staphylococcus aureus enterotoxin-b mutant
Class: enterotoxin
Keywords: enterotoxin, staphylococcal enterotoxins, seb, enterotoxin b
Deposited on 2001-10-29, released 2002-02-13
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.227
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enterotoxin type b
    Species: Staphylococcus aureus [TaxId:1280]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01552
      • engineered mutation (111)
    Domains in SCOPe 2.03: d1goza1, d1goza2
  • Chain 'B':
    Compound: enterotoxin type b
    Species: Staphylococcus aureus [TaxId:1280]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01552 (0-End)
      • engineered mutation (111)
    Domains in SCOPe 2.03: d1gozb1, d1gozb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gozA (A:)
    esqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgn
    ydnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrkscmyggvte
    hngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnns
    pyetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gozA (A:)
    esqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgn
    ydnvrvefknkdladkykdkyvdvfganyyyqcyfskdkrkscmyggvtehngnqldkyr
    sitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnspyetgyikfi
    enensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gozB (B:)
    esqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgn
    ydnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrkscmyggvte
    hngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnns
    pyetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gozB (B:)
    esqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgn
    ydnvrvefknkdladkykdkyvdvfganyyyqcyfskdkrkscmyggvtehngnqldkyr
    sitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnspyetgyikfi
    enensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkk