PDB entry 1got

View 1got on RCSB PDB site
Description: heterotrimeric complex of a gt-alpha/gi-alpha chimera and the gt-beta-gamma subunits
Class: complex (GTP-binding/transducer)
Keywords: complex (GTP-binding/transducer), g protein, heterotrimer signal transduction
Deposited on 1996-08-07, released 1997-03-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.207
AEROSPACI score: -1.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gt-alpha/gi-alpha chimera
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04695
      • modified residue (48)
      • modified residue (83)
      • modified residue (103)
      • modified residue (105)
      • modified residue (114)
      • modified residue (118)
      • modified residue (193)
      • conflict (215)
      • conflict (219-220)
      • conflict (224)
      • conflict (227)
      • conflict (230)
      • conflict (233)
      • conflict (235)
      • conflict (238)
      • conflict (242-243)
      • conflict (246)
      • conflict (251-253)
      • conflict (255-256)
      • conflict (260)
      • conflict (268)
      • conflict (270)
      • conflict (276-277)
      • conflict (279)
      • conflict (282)
      • conflict (284)
      • conflict (286)
      • conflict (288)
      • conflict (293)
      • modified residue (307)
      • modified residue (318)
    Domains in SCOPe 2.06: d1gota1, d1gota2
  • Chain 'B':
    Compound: gt-beta
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gotb_
  • Chain 'G':
    Compound: gt-gamma
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gotg_
  • Heterogens: GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gotA (A:)
    mgagasaeekhsrelekklkedaekdartvkllllgagesgkstivkqmkiihqdgysle
    eclefiaiiygntlqsilaivramttlniqygdsarqddarklmhmadtieegtmpkems
    diiqrlwkdsgiqacfdraseyqlndsagyylsdlerlvtpgyvpteqdvlrsrvkttgi
    ietqfsfkdlnfrmfdvggqrserkkwihcfegvtaiifcvalsdydlvlaedeemnrmh
    esmklfdsicnnkwftdtsiilflnkkdlfeekikksplticypeyagsntyeeagnyik
    vqflelnmrrdvkeiyshmtcatdtqnvkfvfdavtdiiikenlkdcglf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gotA (A:)
    saeekhsrelekklkedaekdartvkllllgagesgkstivkqmkiihqdgysleeclef
    iaiiygntlqsilaivramttlniqygdsarqddarklmhmadtieegtmpkemsdiiqr
    lwkdsgiqacfdraseyqlndsagyylsdlerlvtpgyvpteqdvlrsrvkttgiietqf
    sfkdlnfrmfdvggqrserkkwihcfegvtaiifcvalsdydlvlaedeemnrmhesmkl
    fdsicnnkwftdtsiilflnkkdlfeekikksplticypeyagsntyeeagnyikvqfle
    lnmrrdvkeiyshmtcatdtqnvkfvfdavtdiiiken
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gotB (B:)
    mseldqlrqeaeqlknqirdarkacadatlsqitnnidpvgriqmrtrrtlrghlakiya
    mhwgtdsrlllsasqdgkliiwdsyttnkvhaiplrsswvmtcayapsgnyvacggldni
    csiynlktregnvrvsrelaghtgylsccrflddnqivtssgdttcalwdietgqqtttf
    tghtgdvmslslapdtrlfvsgacdasaklwdvregmcrqtftghesdinaicffpngna
    fatgsddatcrlfdlradqelmtyshdniicgitsvsfsksgrlllagyddfncnvwdal
    kadragvlaghdnrvsclgvtddgmavatgswdsflkiwn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gotB (B:)
    seldqlrqeaeqlknqirdarkacadatlsqitnnidpvgriqmrtrrtlrghlakiyam
    hwgtdsrlllsasqdgkliiwdsyttnkvhaiplrsswvmtcayapsgnyvacggldnic
    siynlktregnvrvsrelaghtgylsccrflddnqivtssgdttcalwdietgqqtttft
    ghtgdvmslslapdtrlfvsgacdasaklwdvregmcrqtftghesdinaicffpngnaf
    atgsddatcrlfdlradqelmtyshdniicgitsvsfsksgrlllagyddfncnvwdalk
    adragvlaghdnrvsclgvtddgmavatgswdsflkiwn
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1gotG (G:)
    mpviniedpviniedltekdklkmevdqlkkevtlermlvskcceefrdyveersgedpl
    vkgipedknpfke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gotG (G:)
    ltekdklkmevdqlkkevtlermlvskcceefrdyveersgedplvkgipedknpfke