PDB entry 1gos

View 1gos on RCSB PDB site
Description: human monoamine oxidase b
Class: oxidoreductase
Keywords: oxidoreductase, fad-containing amine oxidase
Deposited on 2001-10-26, released 2001-11-29
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.23
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: monoamine oxidase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1gosa1, d1gosa2
  • Chain 'B':
    Compound: monoamine oxidase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1gosb1, d1gosb2
  • Heterogens: FAD, NYP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gosA (A:)
    msnkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsy
    vgptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwr
    tmddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethev
    salwflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidq
    trenvlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivy
    ykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeer
    lkklcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdr
    iyfagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqpittt
    flerhlpsvpgllrliglttifsatalgflahkrgllvrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gosA (A:)
    kcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsyvgp
    tqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwrtmd
    dmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethevsal
    wflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidqtre
    nvlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivyyke
    pfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeerlkk
    lcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdriyf
    agtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqpitttfle
    rhlpsvpgllrligltt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gosB (B:)
    msnkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsy
    vgptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwr
    tmddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethev
    salwflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidq
    trenvlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivy
    ykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeer
    lkklcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdr
    iyfagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqpittt
    flerhlpsvpgllrliglttifsatalgflahkrgllvrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gosB (B:)
    kcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsyvgp
    tqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwrtmd
    dmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethevsal
    wflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidqtre
    nvlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivyyke
    pfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeerlkk
    lcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdriyf
    agtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqpitttfle
    rhlpsvpgllrli