PDB entry 1gon

View 1gon on RCSB PDB site
Description: b-glucosidase from streptomyces sp
Class: hydrolase
Keywords: glycosyltransferase, family 1 of glycosyl hydrolase
Deposited on 2001-10-22, released 2002-11-07
The last revision prior to the SCOP 1.75 freeze date was dated 2002-11-07, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.198
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-glucosidase
    Species: Streptomyces sp.
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59976
      • conflict (142)
      • conflict (149)
      • conflict (245)
    Domains in SCOP 1.75: d1gona_
  • Chain 'B':
    Compound: Beta-glucosidase
    Species: Streptomyces sp.
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59976 (Start-478)
      • conflict (142)
      • conflict (149)
      • conflict (245)
    Domains in SCOP 1.75: d1gonb_
  • Heterogens: HG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gonA (A:)
    mvpaaqqtatapdaaltfpegflwgsatasyqiegaaaedgrtpsiwdtyartpgrvrng
    dtgdvatdhyhrwredvalmaelglgayrfslawpriqptgrgpalqkgldfyrrladel
    lakgiqpvatlyhwdlpqelenaggwperataerfaeyaaiaadalgdrvktwttlnepw
    csaflgygsgvhapgrtdpvaalraahhlnlghglavqalrdrlpadaqcsvtlnihhvr
    pltdsdadadavrridalanrvftgpmlqgaypedlvkdtagltdwsfvrdgdlrlahqk
    ldflgvnyysptlvseadgsgthnsdghgrsahspwpgadrvafhqppgettamgwavdp
    sglyellrrlssdfpalplvitengaafhdyadpegnvndperiayvrdhlaavhraikd
    gsdvrgyflwslldnfewahgyskrfgavyvdyptgtripkasarwyaevartgvlpta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gonA (A:)
    altfpegflwgsatasyqiegaaaedgrtpsiwdtyartpgrvrngdtgdvatdhyhrwr
    edvalmaelglgayrfslawpriqptgrgpalqkgldfyrrladellakgiqpvatlyhw
    dlpqelenaggwperataerfaeyaaiaadalgdrvktwttlnepwcsaflgygsgvhap
    grtdpvaalraahhlnlghglavqalrdrlpadaqcsvtlnihhvrpltdsdadadavrr
    idalanrvftgpmlqgaypedlvkdtagltdwsfvrdgdlrlahqkldflgvnyysptlv
    sahspwpgadrvafhqppgettamgwavdpsglyellrrlssdfpalplvitengaafhd
    yadpegnvndperiayvrdhlaavhraikdgsdvrgyflwslldnfewahgyskrfgavy
    vdyptgtripkasarwyaevartgvlpt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gonB (B:)
    mvpaaqqtatapdaaltfpegflwgsatasyqiegaaaedgrtpsiwdtyartpgrvrng
    dtgdvatdhyhrwredvalmaelglgayrfslawpriqptgrgpalqkgldfyrrladel
    lakgiqpvatlyhwdlpqelenaggwperataerfaeyaaiaadalgdrvktwttlnepw
    csaflgygsgvhapgrtdpvaalraahhlnlghglavqalrdrlpadaqcsvtlnihhvr
    pltdsdadadavrridalanrvftgpmlqgaypedlvkdtagltdwsfvrdgdlrlahqk
    ldflgvnyysptlvseadgsgthnsdghgrsahspwpgadrvafhqppgettamgwavdp
    sglyellrrlssdfpalplvitengaafhdyadpegnvndperiayvrdhlaavhraikd
    gsdvrgyflwslldnfewahgyskrfgavyvdyptgtripkasarwyaevartgvlpta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gonB (B:)
    altfpegflwgsatasyqiegaaaedgrtpsiwdtyartpgrvrngdtgdvatdhyhrwr
    edvalmaelglgayrfslawpriqptgrgpalqkgldfyrrladellakgiqpvatlyhw
    dlpqelenaggwperataerfaeyaaiaadalgdrvktwttlnepwcsaflgygsgvhap
    grtdpvaalraahhlnlghglavqalrdrlpadaqcsvtlnihhvrpltdsdadadavrr
    idalanrvftgpmlqgaypedlvkdtagltdwsfvrdgdlrlahqkldflgvnyysptvs
    hspwpgadrvafhqppgettamgwavdpsglyellrrlssdfpalplvitengaafhdya
    dpegnvndperiayvrdhlaavhraikdgsdvrgyflwslldnfewahgyskrfgavyvd
    yptgtripkasarwyaevartgvlpta