PDB entry 1gob

View 1gob on RCSB PDB site
Description: cooperative stabilization of escherichia coli ribonuclease hi by insertion of gly-80b and gly-77-> ala substitution
Deposited on 1993-05-10, released 1994-01-31
The last revision prior to the SCOP 1.57 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2 Å
R-factor: 0.191
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.57: d1gob__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1gob_ (-)
  mlkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmelmaaivalealk
  ehcevilstdsqyvrqaitqwihnwkkrgwktadkkpvknvdlwqrldaalgqhqikwew
  vkghaghpenercdelaraaamnptledtgyqvev