PDB entry 1go8

View 1go8 on RCSB PDB site
Description: the metzincin's methionine: prtc m226l mutant
Class: hydrolase
Keywords: hydrolase, metalloprotease, protease
Deposited on 2001-10-20, released 2002-10-17
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.169
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'P':
    Compound: protease c
    Species: Erwinia chrysanthemi [TaxId:556]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16317 (Start-461)
      • engineered mutation (208)
    Domains in SCOPe 2.01: d1go8p1, d1go8p2
  • Heterogens: CA, ZN, PO4, HOH

PDB Chain Sequences:

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1go8P (P:)
    antssaynsvydflryhdrgdgltvngktsysidqaaaqitrenvswngtnvfgksanlt
    fkflqsvssipsgdtgfvkfnaeqieqaklslqswsdvanltftevtgnksanitfgnyt
    rdasgnldygtqayayypgnyqgagsswynynqsnirnpgseeygrqtftheighalgla
    hpgeynagegdpsyndavyaedsyqfsilsywgenetgadynghyggapmiddiaaiqrl
    yganmttrtgdsvygfnsntdrdfytatdsskalifsvwdaggtdtfdfsgysnnqrinl
    negsfsdvgglkgnvsiahgvtienaiggsgndilvgnsadnilqggagndvlyggagad
    tlyggagrdtfvygsgqdstvaaydwiadfqkgidkidlsafrnegqlsfvqdqftgkgq
    evmlqwdaansitnlwlheaghssvdflvrivgqaaqsdiiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1go8P (P:)
    tssaynsvydflryhdrgdgltvngktsysidqaaaqitrenvswngtnvfgksanltfk
    flqsvssipsgdtgfvkfnaeqieqaklslqswsdvanltftevtgnksanitfgnytrd
    asgnldygtqayayypgnyqgagsswynynqsnirnpgseeygrqtftheighalglahp
    geynagegdpsyndavyaedsyqfsilsywgenetgadynghyggapmiddiaaiqrlyg
    anmttrtgdsvygfnsntdrdfytatdsskalifsvwdaggtdtfdfsgysnnqrinlne
    gsfsdvgglkgnvsiahgvtienaiggsgndilvgnsadnilqggagndvlyggagadtl
    yggagrdtfvygsgqdstvaaydwiadfqkgidkidlsafrnegqlsfvqdqftgkgqev
    mlqwdaansitnlwlheaghssvdflvrivgqaaqsdiiv