PDB entry 1go7

View 1go7 on RCSB PDB site
Description: the metzincin's methionine: prtc m226c-e189k double mutant
Class: hydrolase
Keywords: hydrolase, protease, metalloprotease
Deposited on 2001-10-20, released 2002-10-17
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.172
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'P':
    Compound: protease c
    Species: Erwinia chrysanthemi [TaxId:556]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16317 (0-461)
      • engineered mutation (171)
      • engineered mutation (208)
    Domains in SCOPe 2.02: d1go7p1, d1go7p2
  • Heterogens: CA, ZN, PO4, HOH

PDB Chain Sequences:

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1go7P (P:)
    antssaynsvydflryhdrgdgltvngktsysidqaaaqitrenvswngtnvfgksanlt
    fkflqsvssipsgdtgfvkfnaeqieqaklslqswsdvanltftevtgnksanitfgnyt
    rdasgnldygtqayayypgnyqgagsswynynqsnirnpgseeygrqtfthkighalgla
    hpgeynagegdpsyndavyaedsyqfsicsywgenetgadynghyggapmiddiaaiqrl
    yganmttrtgdsvygfnsntdrdfytatdsskalifsvwdaggtdtfdfsgysnnqrinl
    negsfsdvgglkgnvsiahgvtienaiggsgndilvgnsadnilqggagndvlyggagad
    tlyggagrdtfvygsgqdstvaaydwiadfqkgidkidlsafrnegqlsfvqdqftgkgq
    evmlqwdaansitnlwlheaghssvdflvrivgqaaqsdiiv