PDB entry 1gnw

View 1gnw on RCSB PDB site
Description: structure of glutathione s-transferase
Deposited on 1996-09-15, released 1997-09-17
The last revision prior to the SCOP 1.63 freeze date was dated 1997-09-17, with a file datestamp of 1997-09-17.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.175
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gnwA (A:)
    gikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafedgd
    lklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklafeq
    ifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyllg
    tptkklfterprvnewvaeitkrpasekvq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gnwB (B:)
    gikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafedgd
    lklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklafeq
    ifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyllg
    tptkklfterprvnewvaeitkrpasekvq