PDB entry 1gng

View 1gng on RCSB PDB site
Description: glycogen synthase kinase-3 beta (gsk3) complex with frattide peptide
Class: transferase
Keywords: transferase, protein kinase, gsk3/frattide complex, phosphorylated, active
Deposited on 2001-10-04, released 2002-10-03
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.196
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen synthase kinase-3 beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1GNG
      • conflict see remark 9 (334)
    • Uniprot P49841
    Domains in SCOPe 2.02: d1gnga_
  • Chain 'B':
    Compound: Glycogen synthase kinase-3 beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1GNG
      • conflict see remark 9 (334)
    • Uniprot P49841
    Domains in SCOPe 2.02: d1gngb_
  • Chain 'X':
    Compound: frattide
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Y':
    Compound: frattide
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gngA (A:)
    mhhhhhhhhhhkvsrdkdgskvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqakl
    cdsgelvaikkvlqdkrfknrelqimrkldhcnivrlryffyssgekkdevylnlvldyv
    petvyrvarhysrakqtlpviyvklymyqlfrslayihsfgichrdikpqnllldpdtav
    lklcdfgsakqlvrgepnvsyicsryyrapelifgatdytssidvwsagcvlaelllgqp
    ifpgdsgvdqlveiikvlgtptreqiremnpnytefkfpqikahpwtkvfrprtppeaia
    lcsrlleytptarltpleacahsffdelrdpnvklpngrdtpalfnfttqelssnpplat
    ilipphariqaaastptn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gngA (A:)
    kvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfkn
    relqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlpv
    iyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvs
    yicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgt
    ptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltpleac
    ahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphariq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gngB (B:)
    mhhhhhhhhhhkvsrdkdgskvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqakl
    cdsgelvaikkvlqdkrfknrelqimrkldhcnivrlryffyssgekkdevylnlvldyv
    petvyrvarhysrakqtlpviyvklymyqlfrslayihsfgichrdikpqnllldpdtav
    lklcdfgsakqlvrgepnvsyicsryyrapelifgatdytssidvwsagcvlaelllgqp
    ifpgdsgvdqlveiikvlgtptreqiremnpnytefkfpqikahpwtkvfrprtppeaia
    lcsrlleytptarltpleacahsffdelrdpnvklpngrdtpalfnfttqelssnpplat
    ilipphariqaaastptn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gngB (B:)
    vsrdkdgskvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkv
    lqdkrfknrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhys
    rakqtlpviyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakql
    vrgepnvsyicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlv
    eiikvlgtptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytpta
    rltpleacahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphari
    

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.